KEGG   Scheffersomyces stipitis: PICST_62189Help
Entry
PICST_62189       CDS       T01023                                 

Definition
hypothetical protein
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
pic  Scheffersomyces stipitis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 356 aa AA seqDB search
TTFCENGCYFSIDSRYELEKVLGKGSYGTVCSAIDTRKSHPDAEYSRIAIKKVSNIFNKD
ILLKRAVRELKFMRHFKGHRNVNLDIVFTKPYDGLYCYQELADLDLARVLYSNIQFSEFH
IQSFIYQILTGLKYIHSADVIHRDLKPGNILVTTQGTLKICDFGLARGVNPRYFKHRSSQ
ITNYVATRWYRAPELMLSEKRYTKAVDLWAVGCILAELYGRKPLFPGKNQMDQIHCIVRV
LGTPLPAVINRNNWKFLLPPRPQYRVSEWSQLYPFASKDGQELIESLLQWDPEKRLSVHQ
AISHRFIEPVRDSNSEALCEVFDFSFENRATTLGELRELLEREVEMFKAERKSAEM
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
accactttctgtgaaaatggatgctatttttccattgactccagatacgagttagagaag
gtgttgggcaagggatcctatggaacagtatgctctgcaatcgatacaagaaaatcacac
cccgatgccgaatactctaggattgcaattaagaaggtgtccaacattttcaacaaggat
atccttctcaaaagagcagttcgtgagttgaaattcatgagacacttcaaaggacacaga
aatgtaaacttagatattgtttttaccaagccatatgacggtctctactgctatcaagaa
ctagcagatctcgacttggctcgagttctctattccaacattcaattttccgagttccac
attcaaagcttcatctaccagattttgaccgggttgaaatacatccactcagctgatgtc
attcatagggatttgaagccaggaaacatattggtaactacacaaggtactctcaaaatc
tgcgattttggactagcaagaggagtcaatccacgttactttaaacaccgttcttcacaa
atcaccaactatgtggctactcgttggtacagagctccagaactaatgctttctgagaag
aggtataccaaggcagttgatctctgggcagttgggtgtattcttgctgagctatatggg
agaaaaccactctttcctggaaagaatcagatggatcagatccactgtatagtacgagta
cttggtacaccccttccagctgtcatcaatagaaacaactggaaatttcttcttccccct
cgtccgcagtacagggtatctgaatggagccaattgtatccatttgcttccaaggatggg
caggagcttattgaaagcttgttacaatgggatccagagaagagattaagcgtacaccaa
gccatcagccaccggttcattgaacctgtcagagactccaatagtgaagctctatgtgag
gtgttcgatttcagttttgaaaacagggctacgactttaggagaactacgtgaactattg
gagagagaggtagagatgttcaaagcggagcggaagctggcggaaatgtaa

DBGET integrated database retrieval system