KEGG   Scheffersomyces stipitis: PICST_62413Help
Entry
PICST_62413       CDS       T01023                                 

Definition
hypothetical protein
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
pic  Scheffersomyces stipitis
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:pic00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    PICST_62413
Enzymes [BR:pic01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     PICST_62413
Peptidases [BR:pic01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PICST_62413
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 848 aa AA seqDB search
MTEEPVSFRSIADLNSLSKSLLRDLITGSSGISKLIKHQVSLLELYSHESKKLERIGYCD
YELAYVCYTLALSLYTNSEKLLSEKTVDFVRSIKQNLVIRKDSYETIRSFLDSNENETNV
DPSNLGSYVSVGHVKANLKSSMDNFKYREVIFVEELHNIISSTSSSKVLLIDYRASKDFN
YNHIKHSEIINIEPSHINAIFSQNKDVTDQDLEERLKLHLSQDQFHKFQNRYKYDLIVIY
NLKYGTHMSHMDRFAYLKEVLLNEDSSALPTRNPFNNLVELIMFKNKYISSKLKRHPCYL
AGGVFHWHSVYGDDSFYTGTSYGNSSSIARTSSPYLKNFGEYLSTAKSTDDTPISNAFVP
IIPSASMSKYNPSSAIKSSTSSSTITTTNVSPPIQQPPTVKRTLSVTIPNNSSSSSTTTS
ITEKPTIASVAGITTNNTPSKFLDSYVTGLVNLGNSCYMNCILQCLGATPPLTKFFFPGI
SNSLPSSSQVQSYRQHINVNNKLGSKGIMTTNFFGLLANMFNSNGKSYSPTNFKKVMGSL
SPGGQFATFDQQDCLEFLTFLLDGLHEDLNQMVISNPEEKKAISELTPEQEKTREILPVR
LASTIEWERYLKLNFSIIVDYFQGQYLSQLKCLECGMTSTTYNAFSVLSLPIPEKLGYST
NQRVSLDDCLKEFTTTELLDDNNKWHCPRCKRFTKSTKKITITRLPQILIIHFKRFKMTP
NGYFNKLDTFVNFPVKDTLDLTSYWPDVGTSVNSNLKDSEIMSKEKEEQILSTLPSRNQQ
KPFRYKLYGVANHFGNLTTGHYTSYIHKEGESKKTRGWIYFDDAKLTYNCKESDVMNKNA
YCLFYQRI
NT seq 2547 nt NT seq  +upstreamnt  +downstreamnt
atgactgaggagccggtctcgttcagactgatagctgatttgaatagtctatctaaatcc
ttgcttcgggatttgatcacaggttcatcaggcatatcgaaacttattaagcatcaagtg
tctcttcttgagttgtactctcatgaatcgaagaagctcgagaggatcggctactgtgac
tatgaacttgcctatgtttgctacacgttggcgttgctgctttatacgaacctggagaaa
ctactttcagaaaagactgtggactttgtgcgatcgattaaacagaatctcgtgataaga
aaagacagttacgagacgataaggtcatttctcgattctaatgagaatgagactaatgta
gatcccctgaacttgggttcttatgtttctgttgggcacgtaaaggcaaacttaaaactg
ctgatggacaatttcaagtacagagaagtgatattcgttgaagaattgcacaatatcatc
agtctgacatcttctagcaaagtccttttgatagactatagagcatcgaaagatttcaac
tacaatcatatcaaacattcggaaatcatcaatatcgagccatctcatataaatgcaatc
ttttcacagaataaagacgtcaccgatcaagacttagaggaacggctaaagctccattta
ctgcaggaccaattccacaaattccagaatagatacaagtacgacttaatagtcatctac
aacttgaagtatggcacccatatgtcgcatatggaccgatttgcatatctcaaggaagtc
cttttgaacgaagattcaagtgcacttcctacgagaaaccccttcaataatttggtagaa
ttgatcatgttcaagaacaagtacattagctccaagttgaaacggcatccatgttatttg
gctggcggtgtattccattggcattcggtgtatggggacgacagtttttatacaggcact
tcctatggaaattcttcttctattgctcgaacttcttctccctatcttaagaactttggc
gagtacttgctgacagcaaagtctacagatgatactccaatatccaatgcattcgtgcct
attattccttcggcaagtatgtccaagtacaacccttcatcggcaattaagtccagcact
tctagtagtacgattacgacgacaaatgtttcacctccaattcagcagccaccaaccgtc
aagagaacactttcagtcacaattcctaacaactcttcatcttcttcgacgactacatca
ataacagaaaagcctactattgcgtctgtagccggtataactacaaataacactcccagc
aaattccttgatctgtatgtaactggtttggtaaatttgggtaattcttgttacatgaat
tgtattctacagtgtttgggtgcaactcctcctcttacaaagttctttttcccaggtatt
tccaacagtttgccatcgtcgtcacaggttcaatcttatcgtcaacacatcaatgttaac
aacaaattgggatctaaaggtattatgaccacaaacttctttgggctattagccaatatg
ttcaacagtaatgggaagtcgtattcacctacaaattttaagaaagtgatgggatcctta
tcccctggaggacagtttgccacatttgaccaacaggattgtcttgaattcttgactttt
cttcttgatggtttgcacgaagacttgaatcaaatggtgatatcaaatcctgaagaaaag
aaggccatatcagagctcacgcctgaacaagagaaaacgagagaaatcttacctgttcgt
ttggcttccacaattgaatgggagagatatttgaagctcaacttctcaatcattgtcgac
tattttcagggtcagtacttgtcgcaattgaaatgtttggaatgtggaatgacttcaacc
acctacaatgctttttcggttttatcattacctattcctgaaaaacttggctattcaact
aaccaaagagttctgttggatgattgtcttaaggagtttacaactactgaattgttggat
gacaacaacaaatggcattgccctcgttgtaagagattcaccaagctgacgaagaagatc
actatcacacgtttaccgcagatcttgattattcacttcaaaagatttaagatgactccc
aatggttactttaacaagttggatacatttgtcaactttccagttaaagacactcttgac
ttgacatcttattggccagatgttggtaccagtgtcaattcgaatctcaaggattctgag
atcatgagtaaagagaaagaagagcagattttgtcaacattgcccagcagaaaccaacag
aaaccgttccgctacaagctttacggtgttgctaaccattttggaaatttgacaactggc
cattacacttcttatattcacaaggaaggtgagtcaaaaaagaccagaggctggatctac
tttgatgatgccaagcttacttacaattgtaaagaaagcgacgtaatgaataagaatgcc
tactgtcttttctatcaacgtatctaa

DBGET integrated database retrieval system