KEGG   Scheffersomyces stipitis: PICST_62908Help
Entry
PICST_62908       CDS       T01023                                 

Definition
hypothetical protein
Orthology
K11871  
ubiquitin carboxyl-terminal hydrolase 7/11 [EC:3.1.2.15]
Organism
pic  Scheffersomyces stipitis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7
AA seq 879 aa AA seqDB search
MNSEVNDKSNQQYYTKVINHEFRNLQLDPELASKSLFDLIDYCELLYEKSATAFSSGDHH
NGLKNYIKGYLIFNYFINSFIMLHFKGFDAFVESNEQDFIIYLNVFAFYNADDIIRNSSH
TVSSATLRGYIKKYLVDSNLLSFNVEELYAWLHEYIKYLKEKDRSMVEINISSGDEMRSD
GDLFVETATSSSTRQTSNGNSSITNDSVSEFKHRFPSLNGKNDTSLFGSKKLPPPSPPNI
PHPIPKHFSPSLLPPHSPPPPPPHSAANTLQPNRASTFPGSPTASAPYPPDEITSRSPIP
SPISPGLRSPVAPELANDTDEWYFSNPQKSPTDANPNTNSYSNLQNNSGNISHRPPQTIP
IARPVTSPTNNGNNNHYMNNNNVFHNGQQSNNPFPNYPQQQEVGQQVNQQGANGYYDNNG
PSSVQHFGAPRSSVPQHVQMQQYQIKTQKQQYMQEYSVCGLRNFGSSCYINSTIQLIFGV
SLFKSLFINSAYQRYVKDPKYLRLISSSKLNSHHKDSILLSEAISALLRTFSQHGSVSIA
PTKFIRVTSLLKPDFNIPYEQQDAQEFLLFVLERLHSELSNKSIETNYELEDYIRKWDIN
VNMKDRNEYLKWYLSLVKSEGTSPVHDLFQGHLQNKLTCNSCGYESISYSPFTILSLPIP
SSHSSKNVVNLADCLRYYSQDEVLSGENAWNCPKCSKNGDQVSASSVLDNHPVFVNKKSG
IFKLGRRSKSPSSQTSTKTTTSSIHSNISTKSLNFIKLPQILIIQLSRFSVFNLTDKLDT
YIQYPLKLKFNNDGHEIVYKLSGLINHFGNLKSGHYTSIVNKSTVNQNLGSNLDNLKVPY
WCLFDDENVKVNLPHGSITQPGMGAINSKDVYVLCYERV
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atgaatagtgaagtcaatgacaagtccaaccaacagtattacaccaaagtgatcaaccac
gaattccggaacctccagctcgatcctgaattagcgtcaaaatcgctatttgatctcatt
gactactgtgaacttttatacgagaagtctgccacggcgttctcttccggtgatcaccac
aacggattgaagaattacatcaagggatacttgatcttcaactatttcattaacagcttc
attatgctccactttaagggctttgacgcctttgtcgagtccaacgagcaggacttcatc
atctatctcaatgtatttgccttttataacgctgacgacattatacgaaacagctcacac
acagtttcgctggcgacgcttcgcggctacatcaaaaagtaccttgtcgactcaaacttg
cttagttttaacgtggaggagctttatgcctggctccatgagtatataaaatacctcaag
gaaaaagaccgatccatggtggaaatcaatatctccagtggtgacgaaatgcgctcagat
ggtgatctttttgtcgaaactgcaacgtcgtcttcaacaagacagacgtctaatggaaat
tctctgatcacaaacgattctgtctcagaattcaagcacagatttccgtccttaaatggg
aaaaatgatacatcgctctttggttctaagaagcttcctccaccttcgcctccaaatatt
ccacatccaattccaaagcacttttctccatctttgcttcctccacattctccgccacct
cctccgcctcattctgctgcaaatacattacaaccaaatagagctagtacgtttccagga
tcacctacagcttcggctccgtatcctcctgacgaaattacaagcagatcaccaattccg
tcgccaatatctccgggtttgagatctccggttgctccagaattggccaacgatacagac
gagtggtatttcctgaatccacaaaaatcacctactgatgcaaacccaaatacaaattca
tatagcaatctacagaacaatagcggcaatatttcccaccgtcctccacaaacgattccc
atagctaggccggtgacgctgcctacaaacaatggtaacaataaccactacatgaataac
aataatgtctttcacaatggccaacaatccaacaacccatttcctaactatcctcaacag
caagaggtaggccagcaagtaaatcaacaaggagcgaatggttattatgacaataatggt
cctagcagtgtgcaacatttcggagcacctcgctcttctgttcctcaacatgtgcagatg
caacagtatcagatcaaaactcagaagcagcaatacatgcaagagtattctgtttgtgga
ttgagaaactttggttcttcctgttatatcaacctgacaatacagttgatattcggtgtt
ctgttgttcaagtcgttgttcatcaacctggcgtaccagagatatgtcaaggatcccaag
tacttgagacttatcctgtcgctgaagttgaacagtcaccacaaagattctattcttctc
tctgaagcaatttcagcattgttacgaactttctcacagcatggaagtgtttctatagct
cctacaaagttcatcagagtgacgtccttgttgaagccagacttcaatattccatacgaa
cagcaggatgcacaggagtttctactctttgttttggagagacttcatctggagttgtcc
aataagagcattgaaaccaactacgagctagaggactatattcgtaagtgggatattaat
gtcaatatgaaggatagaaacgaatacttgaagtggtacttgtcccttgtgaaactggaa
ggaacgtctccagtccatgatcttttccagggccacttgcaaaacaaattgacatgtaat
tcttgtggatatgagtctattagttattctccatttaccattttgtcactaccgattcca
agcagccatagcagtaagaatgtggtcaacttagccgattgtttacgctactactcccag
gatgaagttctcagtggagaaaatgcctggaactgtcccaagtgtagcaagaacggagac
caagtttctgctagcagtgttcttgataatcatcctgttttcgtcaacaagaagtcagga
atcttcaaactaggcagaagaagcaaatcgccttcttctcagacgagcacgaaaacaacg
acaagttccattcactccaacatttcaacgaagagtttgaacttcatcaaattgccacag
attttgattattcaactctcccggttttcagtcttcaacttgactgataagttagacaca
tacattcaatatccgttgaaattgaagttcaataatgacggtcatgaaattgtgtacaaa
ttatccggtttgataaatcactttggtaatcttaaaagcgggcactacacatccattgtc
aacaaatctacggtcaatcaaaatctaggaagtaatttggacaatctcaaagttccttat
tggtgtttgtttgatgatgagaatgtgaaggtgaacttgcctcacggaagtattacgcag
cctggtatgggtgctatcaactccaaggatgtctatgtgttgtgctacgaacgagtctaa

DBGET integrated database retrieval system