KEGG   Scheffersomyces stipitis: PICST_63000Help
Entry
PICST_63000       CDS       T01023                                 

Gene name
CYP559
Definition
cytochrome P450 (EC:1.14.14.1)
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
pic  Scheffersomyces stipitis
Pathway
Fatty acid degradation
Tryptophan metabolism
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:pic00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:pic00380]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7
AA seq 531 aa AA seqDB search
ILGVFLAYHLILYPFFLSPLRDVPGPYLHRISSLSSLNKQRKGRWTMTVYELHKRYGDVV
VLSPTEVSVNGNSKYVHDIYIKNFPKAKFYENFRNHGFKDNMFASLENDRHIAYKKLIMN
LYSKSAIFNKKNGTHSIIVQKVGQLVDDIRQSSSGKTQNLGIEVYTLFASLAMDVVSAFE
LGMSNGTDLLLHPEKRHIIISHRQVASMVFWTTLMPRFWNWAASSTILKASYDITKWQLG
LYAQAEENVPDVKEDENKSTLETLKQKGLKGEYAYSFLTDNIFAGHETTAIQLAYMCYEL
SRPKNLHLQESLRKELIREFGHPKSEKDIIDDMSKVDVLPYLNSVLDENSRVHASIPGSE
PRLVDSPYKVEVGEGKVVELPKGTGISCVVYALHRQSDVFAEPDQFIPERWLQYENEPDE
VFRQRIKRMQRYMMPFGKGIRMCLGMNLALIEMKMAIANLYWHYNSKICSDWCEITEYTE
DSKKLNPILMGETRKGENRTDEEKMTMYDSYTTRPLNDECWLEWYDNQFEN
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atacttggagtttttcttgcttaccatctcattctttatccgttcttcttatcaccttta
agagatgttccaggtccatatttacatcgaatctctagtctctcctctttgaacaaacag
aggaagggacggtggactatgacggtttacgagttgcacaagaggtatggagacgttgtg
gtattatctccaacagaggtttcagtaaatggaaattccaaatatgttcatgatatatat
atcaagaacttccccaaagcaaagttctacgaaaattttcgcaatcacggcttcaaggac
aacatgttcgcgagtttggaaaatgacagacacattgcctacaagaaactaattatgaac
ttgtacagcaaaagtgccatcttcaataagaagaatggaacacatagtatcattgttcaa
aaagtagggcaattggtcgatgacatacgccaaagttcgtctggaaagacccagaattta
ggaatcgaggtttacaccttatttgcatcgctagccatggacgttgtttctgctttcgag
ttgggaatgagcaatggcacagatttgttattacatcccgagaaacgtcacattattatc
agtcacagacaggttgcaagcatggtgttctggacaactttaatgcctcggttctggaac
tgggccgcgagctctaccatcttgaaggctctgtatgacattactaaatggcaacttgga
ttatatgctcaggcagaagagaatgttcccgacgtaaaagaagatgaaaataagtcgacg
cttgaaacattgaaacagaagggtctcaagggggaatatgcttattccttcttgactgac
aacatatttgctggccacgaaaccactgccatccagcttgcgtacatgtgctacgagctc
tcgcgtccgaagaatctccacttgcaagaatctttgagaaaggaattgattagagaattt
ggtcatcccaagtctgaaaaggatatcattgatgatatgagcaaagtcgatgtccttccg
tatttaaattctgttctagatgagaattctagagtacatgcttcaattcctggctctgag
ccacgtttagtagattctccctacaaagtcgaagttggcgagggtaaagtggtagaatta
cccaaaggtactggtatttcttgtgtggtttatgcattacatagacaatctgatgtattt
gcagaaccagaccaatttatccctgaaagatggttacaatatgaaaacgagcctgacgaa
gttttcagacaaaggatcaagcgaatgcaacgttacatgatgccattcggaaaaggaatt
agaatgtgtttgggaatgaacctcgcattgattgagatgaagatggccattgctaacctt
tactggcactacaattccaagatatgtagtgactggtgtgaaatcaccgaatacacagaa
gacagtaaaaagctcaacccaattttaatgggtgaaacaagaaaaggagaaaaccgcact
gatgaagagaaaatgactatgtatgatagctacaccacaagaccccttaacgatgagtgc
tggttggaatggtacgacaatcaatttgagaactag

DBGET integrated database retrieval system