KEGG   Scheffersomyces stipitis: PICST_63917Help
Entry
PICST_63917       CDS       T01023                                 

Gene name
CDC27
Definition
Anaphase promoting complex subunit CDC27 (Cell division control protein 27) (Anaphase promoting complex subunit 3) (EC:4.6.1.1)
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
pic  Scheffersomyces stipitis
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:pic00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    PICST_63917 (CDC27)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    PICST_63917 (CDC27)
   04113 Meiosis - yeast
    PICST_63917 (CDC27)
Protein phosphatases and associated proteins [BR:pic01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     PICST_63917 (CDC27)
Ubiquitin system [BR:pic04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     PICST_63917 (CDC27)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8
AA seq 571 aa AA seqDB search
MQTDTESFPEPAESAFVMQHLRSIIIHSLDSFNFANAEFACERLLAMDLENLDSTYLYNL
TLFRQGKYKSCYAKMINSDACEHLGCVFILGQCCLKLQRYKEGIYHLLKLNYLYNESSLE
EGMNTDSSYDPFFFVTPSQKYHYEFRRKIMPDSSMIYHLLGDLYRGMNDVKNSALNYAQA
LKFNQYDFEAFQELCKLGSVGSRGSLKRNTSTSLMPNEVGSSSAGAGVGAGSKPSILVNK
EIEKSDKYLYKLYIIFAKSFKSMSKYDCYKAIRLLVLLPEREKETPWVLSKLGRLHFEIV
NYKQSEYYFIKLRKLDRTRLEDMEYYSTLLWHLHRKVELTYLANELHDLDTESPITWCTI
GNLLSLTREPDEAIKCFNKAIKLDDSFTYAYTLKGHEYFGNDNYEMALENFRMSLLIDSR
HYNALYGIGMVYINLGDYQKADYHFRKAVSINPINIILICCVGMVLEKLNKKHLALRQYE
LANKLQPTNPLPIFKMAQLLFSMQQYPQALKYFEILKDLAPDEASVHFLLGQLYNVQNDK
FSAIREFTIALNLDPKGNYLIGEAMESLKDK
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacagatacagagctgtttccagagccagcagagtcggcgttcgtaatgcagcat
ttgcgctccatcattatccattcgttggactcgtttaacttcgccaacgcagagtttgcc
tgtgaacgtctcttggccatggacttggagaacttggactcaacatacttgtacaacttg
acgcttttccgtcagggcaagtacaaatcgtgctacgctaaaatgatcaactccgatgcc
tgcgaacatttgggctgtgtgttcatcttgggtcagtgctgcttgaagctccaaagatac
aaagagggtatctaccatttgttgaagttgaactatctctacaacgagtctagcttagaa
gagggcatgaatacagacagcctgtatgatccatttttctttgtcactccgtcgcagaaa
taccactacgaattcagaagaaaaatcatgccggactcctcgatgatataccacttgcta
ggagacttgtaccgagggatgaatgacgtcaagaacagtgccctcaattatgctcaggca
ctcaagttcaaccagtacgatttcgaggcatttcaggaactatgcaaactcggatctgta
ggctcaagaggtagtctaaagagaaacacctcaacatcgttaatgcccaacgaagttgga
tcgagttctgcgggtgctggagtcggagcaggtagcaagccgtcaattcttgttaataag
gaaatcgagaaaagtgataagtacttgtacaaattgtacataatctttgcaaagagtttc
aaaagcatgagtaagtacgattgttacaaggctatcagattgttagtgttattgcctgag
agagagaaggagacaccatgggtgttgagtaagctaggtcgtttgcacttcgagattgtt
aactacaaacagtctgaatactactttatcaagttgagaaagttggaccgaacaagacta
gaagatatggagtactactccacacttttgtggcatttgcatagaaaagtagagttgacc
tatttggcgaacgaattgcatgatttggataccgaatctccaattacatggtgtaccatt
ggtaacttactctctttaaccagagaacccgatgaggcaatcaagtgtttcaacaaagcc
atcaagttggatgatagtttcacctatgcctatacattgaagggacacgaatactttgga
aatgacaactacgaaatggcgctcgagaacttccgcatgagtttgttgatagattcaaga
cactacaatgccttatacggtattggcatggtgtatatcaacctcggggactatcagaaa
gccgactatcatttccgcaaggcagtatccatcaatcccattaatattatcttaatatgc
tgtgttggtatggtactcgaaaagttgaacaagaagcacttggcattgaggcaatatgaa
cttgcgaataaattgcagccaaccaatccattgcctatttttaagatggctcagttgcta
ttctcgatgcagcagtatccacaggcattgaagtactttgagatcttgaaggatttggca
ccggacgaagcttcggttcatttccttttgggacaactctacaacgtccaaaacgacaag
ttcctggccatacgcgagtttaccattgctttgaatttggatcccaagggtaactatctt
attggcgaagcgatggagtctcttaaagacaagtaa

DBGET integrated database retrieval system