KEGG   Scheffersomyces stipitis: PICST_63917Help
Entry
PICST_63917       CDS       T01023                                 

Gene name
CDC27
Definition
(RefSeq) Anaphase promoting complex subunit CDC27 (Cell division control protein 27) (Anaphase promoting complex subunit 3)
  KO
K03350  anaphase-promoting complex subunit 3
Organism
pic  Scheffersomyces stipitis
Pathway
pic04111  Cell cycle - yeast
pic04113  Meiosis - yeast
pic04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:pic00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    PICST_63917 (CDC27)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    PICST_63917 (CDC27)
   04113 Meiosis - yeast
    PICST_63917 (CDC27)
Protein phosphatases and associated proteins [BR:pic01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     PICST_63917 (CDC27)
Ubiquitin system [BR:pic04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     PICST_63917 (CDC27)
Chromosome and associated proteins [BR:pic03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    PICST_63917 (CDC27)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_2 TPR_1 ANAPC3 TPR_8 TPR_12 TPR_16 TPR_11 TPR_6 TPR_14 TPR_9 TPR_19 TPR_10
Motif
Other DBs
NCBI-GeneID: 4840965
NCBI-ProteinID: XP_001386546
JGI: 63917
UniProt: A3M0F8
Position
8
AA seq 571 aa AA seqDB search
MQTDTESFPEPAESAFVMQHLRSIIIHSLDSFNFANAEFACERLLAMDLENLDSTYLYNL
TLFRQGKYKSCYAKMINSDACEHLGCVFILGQCCLKLQRYKEGIYHLLKLNYLYNESSLE
EGMNTDSSYDPFFFVTPSQKYHYEFRRKIMPDSSMIYHLLGDLYRGMNDVKNSALNYAQA
LKFNQYDFEAFQELCKLGSVGSRGSLKRNTSTSLMPNEVGSSSAGAGVGAGSKPSILVNK
EIEKSDKYLYKLYIIFAKSFKSMSKYDCYKAIRLLVLLPEREKETPWVLSKLGRLHFEIV
NYKQSEYYFIKLRKLDRTRLEDMEYYSTLLWHLHRKVELTYLANELHDLDTESPITWCTI
GNLLSLTREPDEAIKCFNKAIKLDDSFTYAYTLKGHEYFGNDNYEMALENFRMSLLIDSR
HYNALYGIGMVYINLGDYQKADYHFRKAVSINPINIILICCVGMVLEKLNKKHLALRQYE
LANKLQPTNPLPIFKMAQLLFSMQQYPQALKYFEILKDLAPDEASVHFLLGQLYNVQNDK
FSAIREFTIALNLDPKGNYLIGEAMESLKDK
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacagatacagagctgtttccagagccagcagagtcggcgttcgtaatgcagcat
ttgcgctccatcattatccattcgttggactcgtttaacttcgccaacgcagagtttgcc
tgtgaacgtctcttggccatggacttggagaacttggactcaacatacttgtacaacttg
acgcttttccgtcagggcaagtacaaatcgtgctacgctaaaatgatcaactccgatgcc
tgcgaacatttgggctgtgtgttcatcttgggtcagtgctgcttgaagctccaaagatac
aaagagggtatctaccatttgttgaagttgaactatctctacaacgagtctagcttagaa
gagggcatgaatacagacagcctgtatgatccatttttctttgtcactccgtcgcagaaa
taccactacgaattcagaagaaaaatcatgccggactcctcgatgatataccacttgcta
ggagacttgtaccgagggatgaatgacgtcaagaacagtgccctcaattatgctcaggca
ctcaagttcaaccagtacgatttcgaggcatttcaggaactatgcaaactcggatctgta
ggctcaagaggtagtctaaagagaaacacctcaacatcgttaatgcccaacgaagttgga
tcgagttctgcgggtgctggagtcggagcaggtagcaagccgtcaattcttgttaataag
gaaatcgagaaaagtgataagtacttgtacaaattgtacataatctttgcaaagagtttc
aaaagcatgagtaagtacgattgttacaaggctatcagattgttagtgttattgcctgag
agagagaaggagacaccatgggtgttgagtaagctaggtcgtttgcacttcgagattgtt
aactacaaacagtctgaatactactttatcaagttgagaaagttggaccgaacaagacta
gaagatatggagtactactccacacttttgtggcatttgcatagaaaagtagagttgacc
tatttggcgaacgaattgcatgatttggataccgaatctccaattacatggtgtaccatt
ggtaacttactctctttaaccagagaacccgatgaggcaatcaagtgtttcaacaaagcc
atcaagttggatgatagtttcacctatgcctatacattgaagggacacgaatactttgga
aatgacaactacgaaatggcgctcgagaacttccgcatgagtttgttgatagattcaaga
cactacaatgccttatacggtattggcatggtgtatatcaacctcggggactatcagaaa
gccgactatcatttccgcaaggcagtatccatcaatcccattaatattatcttaatatgc
tgtgttggtatggtactcgaaaagttgaacaagaagcacttggcattgaggcaatatgaa
cttgcgaataaattgcagccaaccaatccattgcctatttttaagatggctcagttgcta
ttctcgatgcagcagtatccacaggcattgaagtactttgagatcttgaaggatttggca
ccggacgaagcttcggttcatttccttttgggacaactctacaacgtccaaaacgacaag
ttcctggccatacgcgagtttaccattgctttgaatttggatcccaagggtaactatctt
attggcgaagcgatggagtctcttaaagacaagtaa

DBGET integrated database retrieval system