KEGG   Scheffersomyces stipitis: PICST_63917Help
Entry
PICST_63917       CDS       T01023                                 

Gene name
CDC27
Definition
Anaphase promoting complex subunit CDC27 (Cell division control protein 27) (Anaphase promoting complex subunit 3) (EC:4.6.1.1)
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
pic  Scheffersomyces stipitis
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:pic04120]
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:pic04111]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:pic04113]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8
AA seq 571 aa AA seqDB search
MQTDTESFPEPAESAFVMQHLRSIIIHSLDSFNFANAEFACERLLAMDLENLDSTYLYNL
TLFRQGKYKSCYAKMINSDACEHLGCVFILGQCCLKLQRYKEGIYHLLKLNYLYNESSLE
EGMNTDSSYDPFFFVTPSQKYHYEFRRKIMPDSSMIYHLLGDLYRGMNDVKNSALNYAQA
LKFNQYDFEAFQELCKLGSVGSRGSLKRNTSTSLMPNEVGSSSAGAGVGAGSKPSILVNK
EIEKSDKYLYKLYIIFAKSFKSMSKYDCYKAIRLLVLLPEREKETPWVLSKLGRLHFEIV
NYKQSEYYFIKLRKLDRTRLEDMEYYSTLLWHLHRKVELTYLANELHDLDTESPITWCTI
GNLLSLTREPDEAIKCFNKAIKLDDSFTYAYTLKGHEYFGNDNYEMALENFRMSLLIDSR
HYNALYGIGMVYINLGDYQKADYHFRKAVSINPINIILICCVGMVLEKLNKKHLALRQYE
LANKLQPTNPLPIFKMAQLLFSMQQYPQALKYFEILKDLAPDEASVHFLLGQLYNVQNDK
FSAIREFTIALNLDPKGNYLIGEAMESLKDK
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacagatacagagctgtttccagagccagcagagtcggcgttcgtaatgcagcat
ttgcgctccatcattatccattcgttggactcgtttaacttcgccaacgcagagtttgcc
tgtgaacgtctcttggccatggacttggagaacttggactcaacatacttgtacaacttg
acgcttttccgtcagggcaagtacaaatcgtgctacgctaaaatgatcaactccgatgcc
tgcgaacatttgggctgtgtgttcatcttgggtcagtgctgcttgaagctccaaagatac
aaagagggtatctaccatttgttgaagttgaactatctctacaacgagtctagcttagaa
gagggcatgaatacagacagcctgtatgatccatttttctttgtcactccgtcgcagaaa
taccactacgaattcagaagaaaaatcatgccggactcctcgatgatataccacttgcta
ggagacttgtaccgagggatgaatgacgtcaagaacagtgccctcaattatgctcaggca
ctcaagttcaaccagtacgatttcgaggcatttcaggaactatgcaaactcggatctgta
ggctcaagaggtagtctaaagagaaacacctcaacatcgttaatgcccaacgaagttgga
tcgagttctgcgggtgctggagtcggagcaggtagcaagccgtcaattcttgttaataag
gaaatcgagaaaagtgataagtacttgtacaaattgtacataatctttgcaaagagtttc
aaaagcatgagtaagtacgattgttacaaggctatcagattgttagtgttattgcctgag
agagagaaggagacaccatgggtgttgagtaagctaggtcgtttgcacttcgagattgtt
aactacaaacagtctgaatactactttatcaagttgagaaagttggaccgaacaagacta
gaagatatggagtactactccacacttttgtggcatttgcatagaaaagtagagttgacc
tatttggcgaacgaattgcatgatttggataccgaatctccaattacatggtgtaccatt
ggtaacttactctctttaaccagagaacccgatgaggcaatcaagtgtttcaacaaagcc
atcaagttggatgatagtttcacctatgcctatacattgaagggacacgaatactttgga
aatgacaactacgaaatggcgctcgagaacttccgcatgagtttgttgatagattcaaga
cactacaatgccttatacggtattggcatggtgtatatcaacctcggggactatcagaaa
gccgactatcatttccgcaaggcagtatccatcaatcccattaatattatcttaatatgc
tgtgttggtatggtactcgaaaagttgaacaagaagcacttggcattgaggcaatatgaa
cttgcgaataaattgcagccaaccaatccattgcctatttttaagatggctcagttgcta
ttctcgatgcagcagtatccacaggcattgaagtactttgagatcttgaaggatttggca
ccggacgaagcttcggttcatttccttttgggacaactctacaacgtccaaaacgacaag
ttcctggccatacgcgagtttaccattgctttgaatttggatcccaagggtaactatctt
attggcgaagcgatggagtctcttaaagacaagtaa

DBGET integrated database retrieval system