KEGG   Scheffersomyces stipitis: PICST_65573Help
Entry
PICST_65573       CDS       T01023                                 

Definition
hypothetical protein
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.4.19.12]
Organism
pic  Scheffersomyces stipitis
Brite
Enzymes [BR:pic01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PICST_65573
Peptidases [BR:pic01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PICST_65573
Exosome [BR:pic04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PICST_65573
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 803 aa AA seqDB search
MSESLLDIPAGVPDSVPANSRIYKDDCMYTFDTPENNDLGLDVDLKSYQAFSRTDEYNFT
FENYAKTGNNWYLNINKTLKPEEERNKLLYDENGQKSQKLQKLEVREVPDDELYDTKLSI
YDAADDISYPIEKLTLRFQNLVNEILTANSSNRNDEIKQWEQEIFPCEHSVDVEQFDVGT
VDLSRCAECELTENLWICLHCGTLGCGRQQFGTALKGNSHALSHFEKTDHPVAVKLGSLS
ADSEDSCDVYCYRCNDEVKVPNLAEKLLRFGLDLKSTVKTEKSLVELNIDQNMNYDFKLE
GPDGSKLVPVYGKGLTGFLNLGNSCYLNSVVQSLFDLESYQNYFADLSIPDTENPARDLK
TQLLKIYDGLLSGRYSKPGSLKGDDYQLGLKPSSFKNLIGENHEEFKTQRQQDAFEFLIY
LLDKIDNEFGLSLNKELNYLFTSKTVCFNCKHGSSHIDLADNLSVNIEDKVISLDEDTGK
KQYEPVNFIDCFRAYCANEAIEGYRCDNCGSDTAGVAIKSGGFRTFPNVLIVNAKRIKLE
NWVPVKIDVPIEIPDRLDISEFKAPVFASDEVEDEPDSEDTKGTAFEPSREALDTLLAMG
FPETRCLKALFNTGNNSAEDAMNWLFAHMEDVDIDEPFDSSQISPQQSASASAGPSQDAI
DNLTAMGFSQQLAKKALVLNGNDVNSAVEWLFTNPDDDGVIVESGDASKAVVNLSKEKED
LKEQLLESGDSTNGKYELQSVICHKGTSPHTGHYVVFIKKVIDGQEKWVLFNDEKVVVCG
EDSLQDMRTNGYVYFFKKVQQHS
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaatcgttattggatattccagctggagttccggattcagttccggccaactcc
cgcatctacaaggacgattgcatgtacacctttgatacacctgagaacaacgatcttgga
ttggatgtagatttgaagagctaccaggcttttctgagaactgatgagtacaatttcacg
tttgaaaactatgccaaaactggtaataactggtatttgaacatcaacaagactctcaaa
ccagaggaagagagaaacaagctcttgtacgatgagaatggccagaagagccagaagctt
caaaaattggaagtccgagaagttccggatgacgagttgtacgatacgaagttatccata
tacgatgctgctgatgacatttcgtaccctatagagaagttgacattgcgattccagaac
ttggtgaatgagattctcactgccaactcatcgaacagaaacgatgagataaaacaatgg
gaacaggagatatttccttgtgagcactctgtagatgtagaacagttcgacgtaggcact
gtggacttgtcgagatgtgcagaatgtgagttgactgaaaatctctggatctgtcttcat
tgtggaactttaggctgcggaagacagcagtttggcacggcgttgaagggaaactctcat
gcattgtcccatttcgaaaagactgaccatccagtagctgtcaagttgggctccttatca
gcggatagtgaagatagctgtgatgtctattgctatagatgtaatgatgaagtaaaggta
ccaaatttggcagaaaaactcttgaggtttggcttggacttgaagtcaaccgtcaagaca
gaaaaaagtttagtagaattaaacatcgaccagaacatgaactatgacttcaagttagag
ggacctgatggatcgaaattggttccagtttatggtaagggtctcacaggctttcttaat
ttgggcaattcatgttacttaaattctgtggttcaatctttgtttgatttagaatcgtat
caaaactatttcgctgatctcagcattcctgatactgaaaatcctgctcgtgacttgaaa
actcaattgctcaagatctacgatggtttattaagtggcaggtactccaagccaggatcg
ttaaagggagacgactatcagttagggctaaaaccttcttctttcaaaaacttgatcggc
gagaaccacgaggaattcaaaactcagagacagcaagatgcgtttgagttcttgatatat
ttgcttgacaagatagacaacgagtttggtctctcgttgaacaaggaacttaactacttg
ttcaccagtaaaacagtatgtttcaattgtaagcatggatcgctgcatattgacctagct
gacaatttgtcggttaatatagaagacaaggttatttctttagatgaagatacaggtaag
aaacagtatgagcctgtcaattttattgattgcttcagagcttactgtgctaatgaagca
attgagggctatagatgtgacaactgtggctccgataccgcaggagtagctataaagtct
ggaggcttcaggacgtttccaaatgtacttatagtcaatgccaaacggatcaagttggaa
aactgggtacctgtcaagattgatgtaccaattgagattccagacaggttggacatctcc
gaattcaaggctcctgtttttgcaagcgatgaagtagaagatgagcctgactctgaagac
acaaagggcactgcttttgaacctagccgagaagccttggatacgttgcttgccatggga
tttccagagacaagatgtttgaaagcgttgttcaatactggcaacaacagcgccgaagat
gccatgaactggctctttgcccatatggaagatgtagacatcgatgagccattcgattct
ctgcagatatcgccacaacaatctgcttccgcttctgctggcccttcgcaggatgcaatt
gataatctcacagccatgggcttttctcagcagttggccaaaaaggcattggtcttgaac
ggcaacgatgtcaacagcgccgttgaatggttgtttaccaatcctgatgacgacggtgtc
attgttgagtctggcgacgcttcaaaggctgtagtcaacttgtcgaaagagaaggaagat
ttgaaagaacagcttcttgaatctggtgactctacaaacggcaagtacgagttacagtca
gtgatatgccataaaggtacatcgccacacacagggcactacgtagtgtttataaagaag
gtcatcgatggacaggagaagtgggtcttgttcaatgatgaaaaggtggttgtttgtgga
gaagatagcttgcaggatatgagaacaaacggctatgtctacttcttcaagaaggtgcaa
cagcacagttga

DBGET integrated database retrieval system