KEGG   Scheffersomyces stipitis: PICST_65754Help
Entry
PICST_65754       CDS       T01023                                 

Gene name
THR4
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pic  Scheffersomyces stipitis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PICST_65754 (THR4)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PICST_65754 (THR4)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PICST_65754 (THR4)
Enzymes [BR:pic01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PICST_65754 (THR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 511 aa AA seqDB search
MSQKYRSSRSAEPQALSFEDVVMTGLANDGGLFLPSQVPQLPASFLQDWADLSFQELAFN
VLRLYINAAEIPDQDLRDLISKSYSTFRSEEVTPLKKIDDKLYLLELFHGPTYAFKDVAL
QFVGNLFEYFLTRRNAKKVEGEARDVITVVGATSGDTGSAAIYGLRGKKDVSVFILYPTG
RISPIQEEQMTTVEDANVHTLSVNGTFDDCQDIVKSIFGDREFNDKYHVGAVNSINWARI
LAQQTYYFYSYFQLQKKLNDTSAKVRFVVPSGNFGDILAGYYAYKMGLPVDKLIIATNEN
DILDRFMKTGRYEKKAEKDASAAVKATFSPAMDILISSNFERLLWYLIRDSVANGSDEVA
GKTLNSWMQQLKETGSVVADPEVLAGARSIFDSERVDDAETVATIKEVYSAHPESYVLDP
HSSVGVTTSYRFIKKDDKKDNIKYISLSTAHPAKFSEVVNKALDSIAGYSFEKDVLPAEL
KALSTKRKRINLIDEASIEKVKDAIKKELNF
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaaaagtatagatcatcgcgttctgcggagccccaggctttgtcctttgaggat
gtggtcatgaccggtttggccaacgatggaggtttgttccttccctcacaagttccccag
cttccagcttcattcttgcaagactgggcggatttgtctttccaagaattggctttcaat
gtattgagattgtacatcaacgctgctgaaatccctgaccaagacttaagagacttaatc
tccaaatcttactccactttcagatcggaagaagtcactccattaaagaagatcgacgac
aagttgtacttgcttgaattgttccatggtcctacctatgccttcaaggatgttgccttg
cagtttgtcggcaacctctttgagtacttcttgaccagaagaaatgccaagaaggttgaa
ggcgaagctcgtgatgttatcactgtcgttggagctacttctggtgatactggttctgct
gctatctacggcttaagaggtaagaaggatgtgtctgtgttcattctctatccaacaggc
agaatttctcctattcaagaagagcaaatgaccacagtagaggatgccaatgtgcacaca
ttgtcggttaacggtaccttcgatgactgtcaggacatcgtgaagctgatctttggagac
cgcgagttcaatgataagtaccatgttggagctgtcaactccattaactgggcaagaatt
ttggctcaacaaacctactacttttactcatacttccaattgcagaagaagttaaatgac
acatctgcgaaggtcagattcgtcgttccttctggtaacttcggcgatatattggctggt
tactatgcatacaagatgggcttgccagtggacaagttgatcattgccactaatgaaaac
gacattttggatagattcatgaagactggtcgttacgaaaagaaagctgaaaaggacgcc
tctgcggctgtcaaagccacattctcgccagctatggatatcttgatatcatccaacttt
gaaaggttgttgtggtacttgatcagagactccgttgccaacggtagtgacgaagttgct
ggtaagactttgaactcctggatgcaacaattgaaagagactggttctgttgtggctgac
ccagaagttctcgctggagccagatccattttcgattctgaaagagttgatgatgctgaa
actgttgctaccataaaagaagtttactctgctcacccagaaagctacgtgttggatcca
cacagttctgtcggtgttacgacttcctacagattcatcaagaaggacgacaagaaggac
aacatcaagtacatatctttgtctaccgcccatccagccaagttttctgaagttgtcaac
aaggctttggactcgatcgcagggtattctttcgagaaggatgtattgccagctgaattg
aaggctttgagcaccaagcgcaagagaattaacttgattgatgaagcatccatagaaaag
gtcaaggatgccatcaagaaggaattgaacttttag

DBGET integrated database retrieval system