KEGG   Scheffersomyces stipitis: PICST_65784Help
Entry
PICST_65784       CDS       T01023                                 

Definition
hypothetical protein
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
pic  Scheffersomyces stipitis
Brite
Enzymes [BR:pic01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PICST_65784
Peptidases [BR:pic01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   PICST_65784
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 319 aa AA seqDB search
MSESGWNTIDSDAGVFSELVEKLGVKDVEINELYSIDSDSLSQLDPVYGVVFLFKYGKID
REYASNGNRPLDGDYDVDYENKGIFFANQTIQNACATQAVLNILLNKDDVVQLGDELSNF
KSFVTGFDSEIIGETISNSEVIRKVHNSFSSPSLMDEDKPEPPPDYDGRDDGLFHFIGYI
RSGGYIYELDGLKSYPIRHVECSSQQEFYEKLPEVVFKRISLYGDELRFSLLAVTNNKLE
QATRDNDSEAIHSQLMKRETWTNENELRRHDYMGFLVALLTNISKEKNDEEWKKLLEKAK
TKSSKRLAQRIAEQSYGKK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaaagtggctggaacacaatcgactctgacgctggggttttctcggaactagtt
gaaaaactaggtgtgaaagatgttgaaatcaacgagctttactcaattgactctgattca
ttatcacaattagatccggtctacggtgtcgtatttttattcaaatatggaaaaattgat
agagaatacgccagcaacggcaaccgcccgttggacggtgactacgatgtcgattatgag
aacaaaggaatctttttcgctaaccagacgattcagaatgcctgtgctactcaagcagta
ttgaatattttgctaaacaaagacgatgtcgttcagcttggcgacgagttgagcaacttc
aaatcattcgtaactggttttgacagcgaaattattggagaaaccatctccaatagcgaa
gtgattcgtaaagttcataactcgttttcgtctccatcactcatggatgaagataagcct
gaaccacctccagactacgatgggagggatgatggattgttccacttcataggatacatt
cgttcaggtggatatatttacgaattggatggacttaaaagctatccgatcagacatgta
gaatgttcttctcaacaagagttctatgaaaaattaccagaagtagtattcaagcgaatc
tccttgtatggagatgaattacgtttttctttactcgccgtcaccaataacaaattggag
caagccacaagagacaatgatagcgaagccatccattctcagttgatgaagagagaaacc
tggacgaacgagaacgagttgagaagacacgactacatgggattcttggtggcacttttg
acaaatattagcaaggaaaagaacgatgaagagtggaaaaaattattagagaaagccaaa
acaaagagtagtaagagattggcacaaaggattgcagaacagctgtatggaaagaagtaa

DBGET integrated database retrieval system