KEGG   Scheffersomyces stipitis: PICST_66076Help
Entry
PICST_66076       CDS       T01023                                 

Gene name
RMT2
Definition
arginine methyltransferase (EC:2.1.1.2)
Orthology
K18477  
protein arginine N-methyltransferase 2 [EC:2.1.1.-]
Organism
pic  Scheffersomyces stipitis
Brite
Enzymes [BR:pic01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     PICST_66076 (RMT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7
AA seq 417 aa AA seqDB search
MSDLHDLCRFAERPITSKYVDQLNFYLRSGIPATYTIEEAYNYTNDIAAEPTTTTTPLHL
ICTHVPENATAEELKVVDTMVQTLFEYGAGWCLSDVNNDTPGCILIKRKLNHLNIYTQIV
DSGVRAELLLRKVGEFDMEIIEDTDDLDHDRFGEVPELVEEKAEQIEQPKSDEKPDPEES
NKSNQQSYLNTKLEYVDNALITKDRKDGVMMAWETDLMRLGCESLFKGSIIEDNEEDSEI
NILNIGFGMGIIDTMINEKNPTKHYICEAHPDVLAKLKADGWYDKKNVVILEGRWQEQLD
KLLSSGEVYFNGIYYDTFSEHYSDMLELFDYVVGLLKPYGVFSFFNGLGADRQVVYEVYK
KLSELDLANYGLQCTFTSVEVPKETLQENDKSVWDDVKRSYWSCPVYYHPEARFIDL
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacttgcacgatttatgccgattcgctgaaagacccattaccagcaagtatgtg
gaccaattaaacttctatcttagactgggaattccagctacttataccattgaagaggct
tacaactatacaaatgacatagcagccgaaccaaccaccactacaactcctttgcatctc
atttgcacccatgttccagagaacgcaactgctgaagaattaaaagtagttgacactatg
gtgcaaactttgtttgagtacggggctgggtggtgtttgagcgatgtcaacaatgatact
ccaggatgtatacttattaagaggaagttgaatcatttgaatatctacacgcaaatagtg
gattctggtgttagagcagagctcttgttacgaaaagtgggagagttcgatatggaaata
atagaagatacggacgacttggaccacgatcgttttggagaagttcctgaattggtagag
gaaaaagcagaacaaatcgaacaaccaaagagcgacgaaaaaccggatcctgaagagtcc
aacaaatctaatcaacagtcgtaccttaacaccaaattggaatatgtcgacaatgccttg
atcacaaaagatagaaaagatggtgtcatgatggcatgggaaactgatctcatgagattg
ggctgtgaatctcttttcaaaggttcaataatagaagacaacgaagaagattcagagatc
aacatcctcaacattggttttggaatggggataatcgatactatgatcaacgaaaagaat
cctaccaagcactacatctgtgaagctcatcctgatgttcttgccaagttgaaggcggac
ggctggtacgacaagaaaaatgtagttatcttggaaggtagatggcaagaacaattggac
aagttgttgtcttctggtgaggtttacttcaatggtatttactacgatacattttcagaa
cattacctggacatgttggagttgtttgattacgttgttggattattgaagccctatggt
gtattttcgttcttcaacggtttgggtgccgatagacaagtagtatacgaagtctacaag
aaattgctggaacttgatttagcaaactatggcttacaatgtacattcacctcagttgaa
gttcccaaagaaacattgcaagaaaacgacaagagtgtttgggatgacgtcaaaagatct
tactggtcctgtcccgtatactaccatcccgaggctcgcttcatagacttatag

DBGET integrated database retrieval system