KEGG   Scheffersomyces stipitis: PICST_66162Help
Entry
PICST_66162       CDS       T01023                                 

Gene name
GUT1
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pic  Scheffersomyces stipitis
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    PICST_66162 (GUT1)
Enzymes [BR:pic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     PICST_66162 (GUT1)
Exosome [BR:pic04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PICST_66162 (GUT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8
AA seq 626 aa AA seqDB search
MPRRNSKSPTHPVVASIDIGTTSTRVILFSEDGREIAKRQIEYSTSASEGPAESSNTEQF
RRRSSLMRHNEPIYTAEGIAISITDEIEIENNLSSVGPTLRFPQPGWVECMPVHILANAV
QCLVACLITLRKINSDPDLKIKYKLKAIGIANMRETTIVWSRKTGKPLSRGITWTDTRTA
EIVEHLEKITDDEKKKELREKTGLPLSTYFSAAKLRWLLDNDDVIKEEYEKGDGNLMFGT
VDTWLIYHLTREKTFVSDITNASRTYFMNLETKDYDEELLEFWGIDPTKIRLPKIVSSSE
FYGGFSAPILSNLGFHNKITQEAYDILKTISGVPICGCLGDQSASLVGQMAFKSGSAKCT
YGTGCFLLYNTGSTKLISEHGTLTTVGFWFPTLKGEESKPHYALEGSIAVAGSIVQWLRD
NLKLIENAHDIGPLASQVDNSGGVVFVPAFSGLYAPYWDRGARGSLFGMTQYTSAGHIAR
AALEGVCFQVRAILRAMADDAGGSPDFLEEAGGNQNSILSQLAVDGGMSKADEVLQIQAD
ILGPCVAVKRAAISECTALGAAIAAGLAFENPEDRVWKDLDDVIEKIQGNTDNTFKAELP
DLERRKLWKRWERAVERSKGWLDDDE
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgtcgtaatagcaagtctcctacacatcctgtggtagcgtccatcgatatagga
accacctccacaagagtgatattgttttctgaagatggtagggagatcgccaaacgtcag
atcgagtactctacttcggcatcagaaggtccagcggagtctctgaacactgagcagttc
agaagaagatcttctttgatgagacataatgagcccatctatacggctgaaggtattgct
atttcgatcacagacgagatagagatcgaaaacaacctctcttccgtagggcccactttg
cgattcccccaacctggctgggtcgaatgtatgcctgtccacattttggccaatgccgtt
cagtgtttggtagcctgtttgatcacgttgcgtaagatcaacctggatccagacttgaaa
atcaagtataaacttaaggctattggtattgccaacatgagagaaactactattgtgtgg
tcaagaaagacggggaagcctttgagccgtggtatcacatggacagataccagaacggcc
gagattgtagaacatttggagaagattacagacgatgagaaaaagaaggagttacgagaa
aaaactggtttgcctctttcaacatatttctctgcagccaagttgagatggctcttggac
aatgatgatgttatcaaagaagagtatgaaaagggtgatggcaacttgatgttcggaaca
gtcgatacatggttgatctaccatcttacacgggaaaagacatttgtatctgatatcacc
aatgcatcgagaacatatttcatgaaccttgaaaccaaagactatgatgaagagttattg
gagttctggggcatcgatccaaccaagatccgtttgcccaaaatcgtgtctagttctgaa
ttctatggtgggttctccgctcccatcttgtccaacttgggtttccacaacaaaatcact
caggaagcatacgacatcttgaagactatcagcggtgtacctatctgtggatgtctcggt
gatcagtcggcttctttggtaggacaaatggcgttcaagtctggttcggccaagtgtact
tatggaactgggtgtttcttgttgtacaataccggttcaaccaaattgatttcggagcat
ggaactttgactactgtagggttctggttcccaacattgaagggagaagaatctaaaccg
cattatgctttggaaggttcaattgctgttgctggttccatcgtgcaatggttgcgagac
aacttgaagttgattgaaaatgcacacgatattggacctttggcttcacaagtagacaat
tctggtggtgtggtgtttgtgcctgccttttcaggattgtatgctccttactgggatcgt
ggggctcgtggctccttgtttggtatgacgcaatacacttctgctggtcatatcgccaga
gccgcattagaaggtgtctgtttccaagttcgtgccattctcagagccatggctgatgat
gctggtggttcccctgatttcttggaagaagccggtggtaaccaaaacagtatcttgtcg
caattggcagtagatggaggtatgtctaaagcagatgaagtgcttcaaatccaagcagat
atcttagggccctgtgttgccgtcaagagagcggccatttccgaatgtacagctttgggg
gctgccattgcagctggtttggcttttgaaaatcctgaagacagagtctggaaagacctc
gacgatgttatagaaaagatccagggcaacactgacaatacatttaaggcagagttgcca
gatctagaaagaagaaagctctggaagagatgggaaagggcagtagaaagatccaaggga
tggttggatgacgatgagtaa

DBGET integrated database retrieval system