KEGG   Scheffersomyces stipitis: PICST_66299Help
Entry
PICST_66299       CDS       T01023                                 

Gene name
PHO4
Definition
myc-family transcription factor
Orthology
K06658  
phosphate system positive regulatory protein PHO4
Organism
pic  Scheffersomyces stipitis
Pathway
Cell cycle - yeast
Class
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:pic04111]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 550 aa AA seqDB search
MESSVWNSTFSPSNSGATPGKSPYYHELGDAQQHHQQQQHHDATGSNSHSTPSSHYHQMS
GPGPLPSGGTPSNFSDTEQLFLHQLEQNLYEAATSQENTPSSNIANTPNSGSGTGAPGIA
GYPHDIPPPPQSYEYGIENMNFIIPEDLNFDTDPSHESSAFPPSHLPIQTPSMLAANKNL
ATSQKSSAEPDRKSFVSPILPGQNEKSYNNQHFYHKHNSKNLSDFQVQHQSQQAPQQHVR
PDAVFTPLVSPAVTPLDSQVNLNKAPNASSGSTTGGGSSSSTFSQQPPVQVSFEPLTSPA
LNAQPSLNDRRRSSSSVYGPGPVDDHHAHTIYNGSKRRTPHGTPIMHPNKNSPSIKARNG
SGNFRTSPAATSVSAFDELPESSMETSTNDNSNSATPMLPPQGKKIDTSNGGQDVDDIEV
DMTSNAGGLSRKSSRSSRKSFSSNTSNKILPKSSSSSTETSPKLLNEKSSNGIPVIKKSG
EKPATKKASHKLAEQGRRNRMNMAVSELGSLIPQVYHDEVAIPSKATTVELASKYIRALL
QEIDTLKNKS
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atggagctgtcggtgtggaactcgactttctcccccagcaatagcggggctacgccggga
aagtcgccgtattaccacgagcttggtgatgcacaacagcaccaccaacagcaacaacac
catgatgcaacgggttctaattcgcatctgactccttcgagccattaccaccagatgctg
ggcccggggcctcttccatcaggcggaacgccgtccaacttctccgacaccgagcagttg
tttcttcaccaattagagcagaacctctacgaggctgccacttctcaggaaaatactcct
agctcaaatattgccaatacacccaactcgggctctggaactggtgctccaggaattgca
ggctatccgcacgacattcctccaccacctcaactgtacgagtatggaattgagaatatg
aactttataataccggaagacttgaacttcgacacagaccccagtcatgaatcgtcggca
tttcctccgctgcatttgcccattcagacgccgagcatgctagcagccaacaagaacttg
gctactagccagaagctgtcagcagaacctgaccgaaagtcgtttgtctcaccgattttg
ccgggccagaacgagaaatcctataataaccagcatttttaccataaacacaactcaaaa
aacctatccgatttccaggttcaacaccagtcgcaacaggccccacagcaacatgtgagg
cctgatgctgtatttacgccgttagtttcaccagcagtgactcctttggactcacaggtt
aatcttaacaaggccccaaatgcttcttctggctcaaccacaggcggaggctcctcttct
tccactttctcgcagcaacctccagttcaagtctcgtttgagccgttgacttcgccagcg
ttgaacgcccaaccatctctaaatgatagacgtcgttcttcttcttctgtatatggacct
ggacctgtggatgatcaccatgcccatactatctacaacggaagcaagagaaggacacca
cacgggactcctataatgcatccaaacaaaaattctccttcaatcaaggccagaaatggc
tctggtaatttccgcacatctccagcagccactagcgtttctgcatttgacgaattacca
gagtcaagcatggaaaccagcacaaatgacaatagcaacagtgccactccgatgttacct
ccacaaggtaaaaaaatagatacatctaatggtggacaagatgttgatgacattgaggtt
gatatgacgtccaacgctggcggattatcacgtaaatcttcgagatctagtagaaaatca
ttttcatcgaatacttccaacaaaatacttccgaagtcttcttcgtcgagtacggagacg
tcacccaagttgctcaacgaaaaatcttccaacggtattcctgttatcaaaaaaagtggc
gaaaagccagcaaccaagaaagcatctcataaattagctgaacaaggaagaagaaataga
atgaatatggccgttctggaattgggtagtttaattccccaggtctaccatgatgaagtg
gcaattccatccaaagctacaactgttgaattggcatcaaagtacatcagggctctattg
caagagatcgatactttgaaaaataagtcttga

DBGET integrated database retrieval system