KEGG   Scheffersomyces stipitis: PICST_66973Help
Entry
PICST_66973       CDS       T01023                                 

Gene name
PFK2
Definition
(RefSeq) 6-phosphofructokinase beta subunit (Phosphofructokinase 2) (Phosphohexokinase) (6PF-1-K beta subunit) (CaPFK2) (EC:2.7.1.11)
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pic  Scheffersomyces stipitis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PICST_66973 (PFK2)
   01230 Biosynthesis of amino acids
    PICST_66973 (PFK2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PICST_66973 (PFK2)
   00030 Pentose phosphate pathway
    PICST_66973 (PFK2)
   00051 Fructose and mannose metabolism
    PICST_66973 (PFK2)
   00052 Galactose metabolism
    PICST_66973 (PFK2)
  Energy metabolism
   00680 Methane metabolism
    PICST_66973 (PFK2)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    PICST_66973 (PFK2)
Enzymes [BR:pic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PICST_66973 (PFK2)
Protein phosphatases and associated proteins [BR:pic01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PICST_66973 (PFK2)
Messenger RNA biogenesis [BR:pic03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     PICST_66973 (PFK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 946 aa AA seqDB search
MTVPVVNGSSCVSLFASSKELLDHAINFYTNIIGLTFHSETGNCIYLANKDNKLTIELNI
DENGPSEADINAKRQKFVHQLNIHDWRSMESSVVIKCANLNQVIVTLQTFKQPLQISPNE
LFPNEVYTIDPLGNIIGFNAASHPMTLVPPMEKLKPQGLESAAMSASSSHFSRQDEGFKR
RRNIAVMTSGGDAPGMNANVRAVVRAAIFRGCKAFAIMEGYEGLVRGGPDYIKEMTWHDV
RGYLSEGGTNIGTARCKEFRERPGRLLGCKHLIEAGIDALIVCGGDGSLTGADLFRAEWP
SLIQELKDNGDITAQQYDTYKHLNICGTVGSIDNDMATTDATIGAYSSLDRICKAIDYID
ATANSHSRAFVVEVMGRHCGWLALMAGIATSSDYILIPEKPSSSKGWQDQMCTIVGKHRA
EGKRKTIVIVAEGAITSDLIPITANEVKDVLVERLGLDTRVTTLGHVQRGGTAVAYDRML
ATLQGVEAVKAVLEVTPDTPSPLIAIEENKIVRKPLVEAVKITKSVAAAIESKDFERAMS
LRDSEFVEHLSNFMAMNSANHNEPSLPVNKRKRIAILNIGAPAGGMNSAVYAFATYCMSR
GHTPYAIHNGFAGLARHESVRSMKWLEIEGWNSVGGSEIGTNRQTPEETDIGMIAHYFEK
YQFDGLVIVGGFEGFVSLDQLEKARAMYPAFRIPMVLIPATISNNVPGTEYSLGSDTCLN
SLMDYCDVVKQSASATRDRAFIIEVQGGNSGYIATYASLISGAQASYVPEEGIALDQLEL
DIKSLKETFAVDRGLSKSGKLILKSSNASKVLTTQVLADIMKEEGNGEFDTKTAIPGHVQ
QGGLPSPIDRTRAARFAIKAVQFIEDSVDKLAEYKFSLDWPDDNSISATAAVLGVKSSHL
RFKSIRQLYDFETEIGKRMPKKVHWTRTRDVADQLVGRTRMRPPPS
NT seq 2841 nt NT seq  +upstreamnt  +downstreamnt
atgactgttcctgtggtcaatggctcttcttgtgtctcgctctttgcgtcctctaaagag
ctcctcgaccatgccatcaacttctacaccaacatcattggcttgactttccattcggaa
acaggaaactgcatatatttggccaacaaggacaacaagctaactattgagttaaatatt
gatgagaatggcccttctgaagcggatattaatgccaaaagacagaagttcgtccatcag
ttgaacatccatgactggagatcgatggagtcgtcggtagtgataaaatgtgccaacttg
aaccaggtcattgtaacattgcagacgtttaagcaacctcttcaaatcagccccaacgag
ttgtttccaaacgaagtctacactattgaccccttaggaaacatcattggttttaatgct
gcttctcatcccatgactttagttccccctatggagaaattaaagcctcagggtttggaa
tcggcagcaatgtctgctagtagttctcatttctccaggcaagacgaaggatttaagaga
agaagaaacatcgcggtcatgacctcaggtggtgatgctcccgggatgaacgccaacgtt
cgtgccgtcgttagagctgctatcttcagaggttgtaaggcattcgccattatggaaggc
tacgaaggattggtgagaggtggtcctgattatatcaaggaaatgacctggcatgacgtg
agaggctatctctctgaaggtggtacgaatatcggtacggccagatgtaaggagttcaga
gaaagaccaggtagattattgggctgtaagcatctcattgaagcaggtatcgatgccttg
attgtctgtggaggtgatggttctttaactggtgcggatttgtttagagccgaatggccc
tctttaattcaagagttgaaggacaacggcgatataactgctcagcagtatgatacttac
aagcacttgaacatttgtggaactgttggttctattgataatgacatggccactacagat
gccaccatcggtgcatactcgtcgttggacagaatttgcaaggctattgattacatcgat
gctactgccaactcccattctagagcttttgtagtggaagtaatgggtagacactgtggc
tggttggcccttatggccggaattgccaccagctccgactacatcttgattccggaaaag
ccatcctcttctaaggggtggcaagatcagatgtgcaccattgtaggcaagcatagagcc
gaaggcaagagaaagaccatcgtaattgtagcagaaggtgccatcacaagtgacttgatt
ccgataacagctaacgaggtcaaagacgtgttggtggaacgtttaggtttggataccagg
gtcaccaccttgggccatgtgcaaagaggtggtaccgctgttgcttatgatcgtatgttg
gctacattacagggtgttgaagctgtcaaagctgtcttggaagtaacaccagatactcca
tcacctttgatagccattgaagaaaacaagattgtcagaaagcccttagtggaggctgta
aaaatcaccaagtctgtagctgctgctattgagagtaaggatttcgaaagggccatgtcc
ttgagagattctgaatttgtggaacacttgtccaacttcatggctatgaactcggctaac
cacaatgagccatcgttgcctgtaaacaagaggaaacgtatcgctattttgaacatagga
gctccagctggtggtatgaacagtgccgtctatgcctttgcaacttactgtatgtctaga
ggccacactccgtatgcaatccacaatggatttgccggtctagccagacacgagtccgtt
agactgatgaaatggttggaaatcgaagggtggaactcagtaggtggctcggaaatcggt
actaacagacagacacctgaagaaaccgatatcggtatgattgcccattactttgaaaag
taccaattcgacggattggtgattgtaggagggttcgaaggattcgtttccttagaccag
ttggaaaaggcaagagccatgtatccagcttttagaattcctatggtgttgattccagct
actatttccaataacgttcccggtaccgagtactccttgggttctgatacttgtttgaac
tcgttgatggactactgtgatgtggtcaagcagtcggcttctgccaccagagatcgtgct
ttcatcattgaagtccaaggtggcaattccggttacatcgccacttatgcctctttgatt
agtggagcacaagcatcttatgttcctgaagaaggaattgcattagaccagctagaattg
gacatcaagtcgttgaaagaaacgtttgctgtggacagaggtttatccaagtctggtaag
ttgatcttaaagagtagcaacgcttccaaggtgttaactactcaggttcttgctgatatc
atgaaggaagaaggtaacggcgagtttgacaccaagactgctattcctggacatgttcaa
cagggtggtttgccttctcctatagacagaacaagagctgctagatttgctatcaaagca
gttcaattcattgaagattcggtagacaagttagctgagtataagtttagccttgactgg
cccgatgacaatagcatctctgccactgctgctgtgttgggtgtaaagtcgtcgcacttg
agattcaagtccatcagacagttgtacgatttcgaaactgaaattggcaagagaatgccc
aagaaggtccactggacaagaaccagagacgtggccgaccagttggtgggaagaaccaga
atgagacctcctccttcataa

DBGET integrated database retrieval system