KEGG   Scheffersomyces stipitis: PICST_66973Help
Entry
PICST_66973       CDS       T01023                                 

Gene name
PFK2
Definition
6-phosphofructokinase beta subunit (Phosphofructokinase 2) (Phosphohexokinase) (6PF-1-K beta subunit) (CaPFK2) (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pic  Scheffersomyces stipitis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:pic01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:pic01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pic00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:pic00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pic00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pic00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:pic00680]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 946 aa AA seqDB search
MTVPVVNGSSCVSLFASSKELLDHAINFYTNIIGLTFHSETGNCIYLANKDNKLTIELNI
DENGPSEADINAKRQKFVHQLNIHDWRSMESSVVIKCANLNQVIVTLQTFKQPLQISPNE
LFPNEVYTIDPLGNIIGFNAASHPMTLVPPMEKLKPQGLESAAMSASSSHFSRQDEGFKR
RRNIAVMTSGGDAPGMNANVRAVVRAAIFRGCKAFAIMEGYEGLVRGGPDYIKEMTWHDV
RGYLSEGGTNIGTARCKEFRERPGRLLGCKHLIEAGIDALIVCGGDGSLTGADLFRAEWP
SLIQELKDNGDITAQQYDTYKHLNICGTVGSIDNDMATTDATIGAYSSLDRICKAIDYID
ATANSHSRAFVVEVMGRHCGWLALMAGIATSSDYILIPEKPSSSKGWQDQMCTIVGKHRA
EGKRKTIVIVAEGAITSDLIPITANEVKDVLVERLGLDTRVTTLGHVQRGGTAVAYDRML
ATLQGVEAVKAVLEVTPDTPSPLIAIEENKIVRKPLVEAVKITKSVAAAIESKDFERAMS
LRDSEFVEHLSNFMAMNSANHNEPSLPVNKRKRIAILNIGAPAGGMNSAVYAFATYCMSR
GHTPYAIHNGFAGLARHESVRSMKWLEIEGWNSVGGSEIGTNRQTPEETDIGMIAHYFEK
YQFDGLVIVGGFEGFVSLDQLEKARAMYPAFRIPMVLIPATISNNVPGTEYSLGSDTCLN
SLMDYCDVVKQSASATRDRAFIIEVQGGNSGYIATYASLISGAQASYVPEEGIALDQLEL
DIKSLKETFAVDRGLSKSGKLILKSSNASKVLTTQVLADIMKEEGNGEFDTKTAIPGHVQ
QGGLPSPIDRTRAARFAIKAVQFIEDSVDKLAEYKFSLDWPDDNSISATAAVLGVKSSHL
RFKSIRQLYDFETEIGKRMPKKVHWTRTRDVADQLVGRTRMRPPPS
NT seq 2841 nt NT seq  +upstreamnt  +downstreamnt
atgactgttcctgtggtcaatggctcttcttgtgtctcgctctttgcgtcctctaaagag
ctcctcgaccatgccatcaacttctacaccaacatcattggcttgactttccattcggaa
acaggaaactgcatatatttggccaacaaggacaacaagctaactattgagttaaatatt
gatgagaatggcccttctgaagcggatattaatgccaaaagacagaagttcgtccatcag
ttgaacatccatgactggagatcgatggagtcgtcggtagtgataaaatgtgccaacttg
aaccaggtcattgtaacattgcagacgtttaagcaacctcttcaaatcagccccaacgag
ttgtttccaaacgaagtctacactattgaccccttaggaaacatcattggttttaatgct
gcttctcatcccatgactttagttccccctatggagaaattaaagcctcagggtttggaa
tcggcagcaatgtctgctagtagttctcatttctccaggcaagacgaaggatttaagaga
agaagaaacatcgcggtcatgacctcaggtggtgatgctcccgggatgaacgccaacgtt
cgtgccgtcgttagagctgctatcttcagaggttgtaaggcattcgccattatggaaggc
tacgaaggattggtgagaggtggtcctgattatatcaaggaaatgacctggcatgacgtg
agaggctatctctctgaaggtggtacgaatatcggtacggccagatgtaaggagttcaga
gaaagaccaggtagattattgggctgtaagcatctcattgaagcaggtatcgatgccttg
attgtctgtggaggtgatggttctttaactggtgcggatttgtttagagccgaatggccc
tctttaattcaagagttgaaggacaacggcgatataactgctcagcagtatgatacttac
aagcacttgaacatttgtggaactgttggttctattgataatgacatggccactacagat
gccaccatcggtgcatactcgtcgttggacagaatttgcaaggctattgattacatcgat
gctactgccaactcccattctagagcttttgtagtggaagtaatgggtagacactgtggc
tggttggcccttatggccggaattgccaccagctccgactacatcttgattccggaaaag
ccatcctcttctaaggggtggcaagatcagatgtgcaccattgtaggcaagcatagagcc
gaaggcaagagaaagaccatcgtaattgtagcagaaggtgccatcacaagtgacttgatt
ccgataacagctaacgaggtcaaagacgtgttggtggaacgtttaggtttggataccagg
gtcaccaccttgggccatgtgcaaagaggtggtaccgctgttgcttatgatcgtatgttg
gctacattacagggtgttgaagctgtcaaagctgtcttggaagtaacaccagatactcca
tcacctttgatagccattgaagaaaacaagattgtcagaaagcccttagtggaggctgta
aaaatcaccaagtctgtagctgctgctattgagagtaaggatttcgaaagggccatgtcc
ttgagagattctgaatttgtggaacacttgtccaacttcatggctatgaactcggctaac
cacaatgagccatcgttgcctgtaaacaagaggaaacgtatcgctattttgaacatagga
gctccagctggtggtatgaacagtgccgtctatgcctttgcaacttactgtatgtctaga
ggccacactccgtatgcaatccacaatggatttgccggtctagccagacacgagtccgtt
agactgatgaaatggttggaaatcgaagggtggaactcagtaggtggctcggaaatcggt
actaacagacagacacctgaagaaaccgatatcggtatgattgcccattactttgaaaag
taccaattcgacggattggtgattgtaggagggttcgaaggattcgtttccttagaccag
ttggaaaaggcaagagccatgtatccagcttttagaattcctatggtgttgattccagct
actatttccaataacgttcccggtaccgagtactccttgggttctgatacttgtttgaac
tcgttgatggactactgtgatgtggtcaagcagtcggcttctgccaccagagatcgtgct
ttcatcattgaagtccaaggtggcaattccggttacatcgccacttatgcctctttgatt
agtggagcacaagcatcttatgttcctgaagaaggaattgcattagaccagctagaattg
gacatcaagtcgttgaaagaaacgtttgctgtggacagaggtttatccaagtctggtaag
ttgatcttaaagagtagcaacgcttccaaggtgttaactactcaggttcttgctgatatc
atgaaggaagaaggtaacggcgagtttgacaccaagactgctattcctggacatgttcaa
cagggtggtttgccttctcctatagacagaacaagagctgctagatttgctatcaaagca
gttcaattcattgaagattcggtagacaagttagctgagtataagtttagccttgactgg
cccgatgacaatagcatctctgccactgctgctgtgttgggtgtaaagtcgtcgcacttg
agattcaagtccatcagacagttgtacgatttcgaaactgaaattggcaagagaatgccc
aagaaggtccactggacaagaaccagagacgtggccgaccagttggtgggaagaaccaga
atgagacctcctccttcataa

DBGET integrated database retrieval system