KEGG   Scheffersomyces stipitis: PICST_67176Help
Entry
PICST_67176       CDS       T01023                                 

Gene name
CCP2
Definition
cytochrome c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
pic  Scheffersomyces stipitis
Brite
Enzymes [BR:pic01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     PICST_67176 (CCP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 282 aa AA seqDB search
MPFGATSTSLIKAIQEVFPTPGYDDGSLAPIILRLAWHCCATYDISTGNGGSNGATMRFV
PEITDEGNTGLDISRAALEPVKQKFPRISYSDLWTLAGKVAIESMGGPEIPWTAGRVDCR
DDRHVPSNGHLPFADKDAGHIRSTFQRMGFGDQEAVILLGAHSLGRCHKRFSGWEGKWTT
NPIQFSNDFYKVLVNENWQKGTVPETGREQYFNEDKSLMMLNTDMELLRDPEYLRWVIVY
SRDEQAYFRDFAATFGKLLELGISRDINGQVLPKAEFFYNEK
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgccctttggtgccacttccacaagcttgatcaaggctattcaagaggtttttccaacc
ccaggttacgatgatgggtctcttgcacccatcatactccggttagcatggcattgctgt
gcaacgtacgacatttctactggcaatggaggatctaatggagctaccatgagatttgtt
ccggagatcaccgatgaaggcaatactggactagacatatcccgtgctgcccttgaaccc
gtgaaacagaaattccctcggatcagctattctgacctctggacattagcgggtaaagta
gccatagagtccatgggaggaccggagattccatggactgcaggtcgtgttgactgtaga
gatgaccgacatgttcccagtaatgggcatctaccttttgcagataaagatgccggccat
attagaagtacttttcagcgaatgggattcggagaccaggaggctgttattttactcgga
gcacatagcttaggtagatgtcataaaaggtttagcggatgggaaggaaagtggacgaca
aaccctatccaattctccaacgacttctacaaggtcttggtgaatgagaattggcagaag
ggtactgtaccagagactggtagggagcaatacttcaatgaagataaaagtctcatgatg
ctcaacactgatatggagcttcttcgggaccccgagtacctccgctgggttatcgtgtat
agtagagacgagcaagcatatttcagagattttgcagctacattcggcaagctcttggaa
ttaggaatactgagggatatcaacggccaagttcttcctaaagctgagttcttctataat
gagaaatag

DBGET integrated database retrieval system