KEGG   Scheffersomyces stipitis: PICST_68202Help
Entry
PICST_68202       CDS       T01023                                 

Gene name
TPK2
Definition
cAMP-dependent protein kinase catalytic subunit
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
pic  Scheffersomyces stipitis
Pathway
Meiosis - yeast
Class
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:pic04113]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 372 aa AA seqDB search
MEFYQQQQQSQQPQPIAQQHTETHVPQSKPVVQQRIVDAVQQSLLPQRSTVSKGKYSLTD
FSIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKHQVVKMKQVEHTNDERRMLKLVEHPF
LIRMWGTFQDSKNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVTLALEYLHNHDI
IYRDLKPENILLDRNGHIKITDFGFAKEVSTVTWTLCGTPDYIAPEVITTKPYNKSVDWW
SLGVLIFEMLAGYTPFYDSTPMKTYEKILSGKIHYPSFFGADVIDLLSNLITADLTRRLG
NLINGPADIRNHPWFQEVVWEKLLAKDIETPYEPPITAGVGDSSLFDIYAEDKSEDYGSA
GDDPYAEFFGDF
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggaattctatcagcagcagcaacaatctcaacaaccgcagccaattgcacagcagcac
accgaaactcatgtgcctcagagcaagcctgtagtccagcaacgtattgtggatgctgta
cagcagtccttgttgcctcagcgttccaccgtatcgaaaggaaagtactcgttgaccgat
ttttccattatgagaacgttggggaccggctcctttggccgtgtccacttggttcgttct
gttcacaacggcagatactatgccatcaaggtgttaaagaaacaccaagttgtcaagatg
aaacaggtggaacacaccaacgatgaacggagaatgttgaagttagtggagcaccctttt
ctcatcagaatgtggggtactttccaggactccaagaacttgttcatggtgatggactac
attgaaggtggtgaattgttctcgttgttgagaaagtcgcagcgattccccaaccctgta
gccaagttttacgccgctgaagtgactttggcgcttgaatacttgcacaaccacgacatt
atctaccgtgacttgaagcccgaaaatatcttgcttgacagaaacggccatatcaaaatc
actgatttcggttttgccaaggaagtcagcactgtgacatggacactttgtggaacacct
gactacatcgctcccgaggtgattaccaccaaaccatataacaaatctgtggactggtgg
tcgttgggcgtgttaatattcgaaatgttggccggttacactccattctatgattctacc
ccgatgaagacctatgaaaagattttgtcaggaaagatccactatcccagcttctttggg
gctgacgttatagacttgttgtccaacttgataacagccgacttgacgagaagattgggt
aatttgattaacgggcctgctgacatcagaaaccatccatggtttcaagaagttgtctgg
gagaagttgttggccaaagatattgaaactccatacgaacctcccattactgctggtgtc
ggtgattcttcgctctttgacatttatgccgaagataaatctgaagactacggttctgct
ggtgacgatccatacgccgagttcttcggcgacttctag

DBGET integrated database retrieval system