KEGG   Scheffersomyces stipitis: PICST_68202Help
Entry
PICST_68202       CDS       T01023                                 

Gene name
TPK2
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
pic  Scheffersomyces stipitis
Pathway
pic04113  Meiosis - yeast
pic04138  Autophagy - yeast
pic04213  Longevity regulating pathway - multiple species
Module
pic_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:pic00001]
 Cellular Processes
  Transport and catabolism
   04138 Autophagy - yeast
    PICST_68202 (TPK2)
  Cell growth and death
   04113 Meiosis - yeast
    PICST_68202 (TPK2)
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    PICST_68202 (TPK2)
Enzymes [BR:pic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     PICST_68202 (TPK2)
Protein kinases [BR:pic01001]
 Serine/threonine kinases: AGC group
  PKA family
   PICST_68202 (TPK2)
Messenger RNA biogenesis [BR:pic03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     PICST_68202 (TPK2)
Chromosome and associated proteins [BR:pic03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    PICST_68202 (TPK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase YrbL-PhoP_reg
Motif
Other DBs
NCBI-GeneID: 4840206
NCBI-ProteinID: XP_001385642
JGI: 68202
UniProt: A3LYD5
Position
6
AA seq 372 aa AA seqDB search
MEFYQQQQQSQQPQPIAQQHTETHVPQSKPVVQQRIVDAVQQSLLPQRSTVSKGKYSLTD
FSIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKHQVVKMKQVEHTNDERRMLKLVEHPF
LIRMWGTFQDSKNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVTLALEYLHNHDI
IYRDLKPENILLDRNGHIKITDFGFAKEVSTVTWTLCGTPDYIAPEVITTKPYNKSVDWW
SLGVLIFEMLAGYTPFYDSTPMKTYEKILSGKIHYPSFFGADVIDLLSNLITADLTRRLG
NLINGPADIRNHPWFQEVVWEKLLAKDIETPYEPPITAGVGDSSLFDIYAEDKSEDYGSA
GDDPYAEFFGDF
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggaattctatcagcagcagcaacaatctcaacaaccgcagccaattgcacagcagcac
accgaaactcatgtgcctcagagcaagcctgtagtccagcaacgtattgtggatgctgta
cagcagtccttgttgcctcagcgttccaccgtatcgaaaggaaagtactcgttgaccgat
ttttccattatgagaacgttggggaccggctcctttggccgtgtccacttggttcgttct
gttcacaacggcagatactatgccatcaaggtgttaaagaaacaccaagttgtcaagatg
aaacaggtggaacacaccaacgatgaacggagaatgttgaagttagtggagcaccctttt
ctcatcagaatgtggggtactttccaggactccaagaacttgttcatggtgatggactac
attgaaggtggtgaattgttctcgttgttgagaaagtcgcagcgattccccaaccctgta
gccaagttttacgccgctgaagtgactttggcgcttgaatacttgcacaaccacgacatt
atctaccgtgacttgaagcccgaaaatatcttgcttgacagaaacggccatatcaaaatc
actgatttcggttttgccaaggaagtcagcactgtgacatggacactttgtggaacacct
gactacatcgctcccgaggtgattaccaccaaaccatataacaaatctgtggactggtgg
tcgttgggcgtgttaatattcgaaatgttggccggttacactccattctatgattctacc
ccgatgaagacctatgaaaagattttgtcaggaaagatccactatcccagcttctttggg
gctgacgttatagacttgttgtccaacttgataacagccgacttgacgagaagattgggt
aatttgattaacgggcctgctgacatcagaaaccatccatggtttcaagaagttgtctgg
gagaagttgttggccaaagatattgaaactccatacgaacctcccattactgctggtgtc
ggtgattcttcgctctttgacatttatgccgaagataaatctgaagactacggttctgct
ggtgacgatccatacgccgagttcttcggcgacttctag

DBGET integrated database retrieval system