KEGG   Scheffersomyces stipitis: PICST_68297Help
Entry
PICST_68297       CDS       T01023                                 

Gene name
KGD2
Definition
2-oxoglutarate dehydrogenase complex E2 component (EC:2.3.1.12 2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pic  Scheffersomyces stipitis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:pic01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:pic00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:pic00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7
AA seq 438 aa AA seqDB search
MLSRSIKSSLKRAPVSRAVALSATKLSLRMSSGPVSRSIHTATTSGAGFSRISGLTFKRY
ASVTVKVPDMAESITEGTLSALNKNVGDYVNVDETIATVETDKIDVEVNSPVAGTITEFL
VAVDDTVEVGQDLAKIEEGEAPAGGAAPSEAPKEEAAPAAAPAAAPAAAPAAAPKAAPAA
PKAPAPAKKEEPKKEAPVASFTNFSRNEERVKMNRMRLRIAERLKESQNTAASLTTFNEV
DMTNLMEMRKLYKDEFLEKTGIKLGFMGAFAKASCLAAKDIPAVNASIENNDTLVFRDYT
DISVAVATPKGLVTPVVRNAESLSILGIEQEIASLGKKARDGKLTLEDMTGGTFTISNGG
VFGSLYGTPIINMPQTAVLGLHGTKQRPVTVNGQIVSRPMMYLALTYDHRVLDGREAVTF
LKTVKELIEDPRKMLLLE
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgttgtctagatccatcaagtcgtctttgaaacgtgctccagtttccagagctgttgca
ctttctgccaccaagctctctctcagaatgtcttctggtcccgtttccagatcgatccac
actgctactacctctggtgctggtttctccagaatttctggtttgaccttcaagcgttat
gcttctgtcaccgtgaaagttccagacatggccgagtccattaccgaaggtacactttcc
gctctcaacaagaacgtcggagattacgtcaatgtagatgagaccatcgccactgtcgaa
acagacaagattgacgtcgaagtcaactcgcctgttgctggtaccatcaccgagtttctc
gttgctgttgatgacactgtagaagtgggtcaggatctcgctaagatcgaagaaggcgaa
gctccagctggcggagcagccccatctgaagctccaaaagaggaagctgcacctgctgct
gcccctgctgcagctccagccgcagctccagccgctgctccaaaggctgccccagctgct
ccaaaggcaccagctccagctaaaaaggaagaaccaaagaaggaagctccagtcgccagc
ttcaccaacttctccagaaacgaggaaagagtgaaaatgaacagaatgagattaagaatc
gcagaacgtcttaaggaatcgcagaataccgctgcctccttgaccactttcaacgaagtt
gacatgaccaacttgatggaaatgagaaagttgtacaaagacgagttcttggaaaagacc
ggcatcaagttgggtttcatgggtgctttcgctaaggcctcatgtttggctgctaaggat
attccagctgtaaacgcttccatcgaaaacaacgacaccttagtgttcagagactacacc
gacatctccgttgctgttgctactcctaaaggtttggttactcctgtagttagaaacgcc
gaatccttgtctattttgggcatcgaacaagaaatcgcttctttgggtaagaaggccaga
gacggtaagttaactttggaagacatgaccggtggaactttcaccatctccaacggtggt
gttttcggttccttgtatggtactcctatcattaacatgcctcagactgctgtcttaggt
ttgcacggtaccaagcaaagacctgttaccgtcaacggtcagatcgtgtcaagaccaatg
atgtacttggccttgacctacgatcacagagtattggacggccgtgaagctgtgacattc
ttgaagaccgtcaaggagttgatcgaagaccccagaaagatgttgttgttagagtag

DBGET integrated database retrieval system