KEGG   Scheffersomyces stipitis: PICST_69669Help
Entry
PICST_69669       CDS       T01023                                 

Gene name
TRP5
Definition
(RefSeq) tryptophan synthetase (EC:4.2.1.20)
  KO
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
pic  Scheffersomyces stipitis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PICST_69669 (TRP5)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PICST_69669 (TRP5)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PICST_69669 (TRP5)
Enzymes [BR:pic01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PICST_69669 (TRP5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 700 aa AA seqDB search
MSALLKETFARCKKEGRNALVNFITAGYPTIEDTVPILKSMQDAGVDIIELGIPFSDPIA
DGPTIQAANNVALDNGITVPKCLDLVKQAREQGVTVPIILMGYYNPILKYGEIKLIEDSA
RVGANGFIVVDLPPEEAIKFRSSCARYGLSYVPLVAPATTDERLKVLGEIADSFIYVVSK
MGTTGASKSVSSGITELCARVRKFAGSTPIAVGFGVSTREHFLTVGESADGVVIGSRIVT
LIGESKPGERGVTAYKYVKSILGEGFSVNAPTSFSRAVVIDGTETKPVLEEDHKFNPKFG
EFGGQYVPEALHTCLAELEKGFESAVADPEFWKEFKDLYSYIGRPSSLHRAERLTEYAGG
AQIWLKREDLNHTGSHKINNALAQVLIAKRLGKKKIIAETGAGQHGVATATACAKFGLEC
TVFMGAEDVRRQALNVFRMRILGAKVVAVTNGTQTLRDATSEAFRFWVSNLESTHYVVGS
AIGPHPYPTLVRTFQSVIGQETKEQFKTLNGGKLPNAVVACVGGGSNSTGMFSPFEHDTE
VKMLGVEAGGDGLDTDRHSATLTAGIPGVFHGVKTYVLQDSDGQVHDTHSVSAGLDYPGV
GPELAFWKSTGRADFVAATDAQALIGFKLLSQLEGIIPALESSHAIYGGVELAKTMPKDQ
HIVINVSGRGDKDVQSVAEVLPKLGEQIGWDLRFEADPTK
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctttattgaaagaaacttttgctaggtgtaaaaaagagggacgaaatgctttg
gtcaacttcattactgctggttaccctactattgaggacacagttccaatcttgaagagc
atgcaagatgccggtgtagacatcattgaattgggtatcccattctccgacccaattgct
gatggtccaaccatccaagctgctaataatgtcgcgttggacaacggaatcaccgtccca
aagtgcttggacttggtcaagcaagcaagagaacaaggtgtcactgttccaatcatattg
atgggttactacaatccaatcttaaagtacggtgaaatcaagttgattgaggactctgca
agggtaggtgctaacggtttcattgtcgtcgacttgcctcctgaggaagccatcaagttc
agatcgtcttgtgcacgttatggattgtcttatgttcctttggttgcccctgccactact
gatgaaagattgaaggtcttgggagaaatcgcagattcctttatctacgtagtttctaag
atgggtaccactggtgcttccaaatctgtttcttccggtatcactgagttgtgtgctaga
gttagaaaatttgccggctctaccccaattgccgtaggtttcggtgtgtctacaagagag
catttcttaactgttggtgagagcgctgatggtgtggttattggttctagaatcgtgacc
ttaattggtgaatctaagccaggtgaaagaggtgtgaccgcttacaagtatgtcaaatcc
attttaggtgaaggcttttccgtcaatgcgccaacttctttctctcgggctgtagttata
gatggaactgaaactaagccagttcttgaagaggaccacaagttcaacccaaaatttggt
gaatttggtggtcaatatgttcctgaagcattgcacacttgtttggctgaattggagaaa
ggatttgaaagcgcagttgctgatcccgagttctggaaggaattcaaggacttgtactct
tacattggaagaccatcttctttgcatagggccgaaagattgactgaatatgccggaggc
gctcagatctggttgaagagagaagatttgaaccatactggttctcacaagatcaacaat
gccttggctcaagtgttaattgctaagagattaggtaagaagaagattattgctgagact
ggtgctggtcagcatggtgttgctactgctactgcatgtgctaagtttggattggaatgt
accgttttcatgggagccgaagatgtaagacgtcaagccttgaatgtgttcagaatgaga
atcttgggtgcaaaggttgttgctgtcactaatggtacccaaacattgagagatgcgact
tctgaagccttcagattctgggtatcaaacttagagtcaacgcactatgttgtcggttca
gcaattggaccacatccatacccaaccttggttagaaccttccaaagtgttattggtcaa
gaaaccaaagagcagtttaagactttaaacggcggtaagttaccaaacgccgttgttgct
tgtgtcggcggtggttcgaactccactggtatgttctctccttttgaacacgatactgaa
gtcaaaatgttaggtgtcgaagctggtggtgacggcttagacactgatcgccattctgca
actttgacggcaggtattccaggtgtgttccatggtgtcaaaacttacgttcttcaggac
agtgatggacaggttcatgacactcattcagtttctgcgggtttagactatcctggcgta
ggtccagaattggcattttggaagagcactggtcgtgctgacttcgttgctgctacagat
gctcaggcattgatcggatttaaattattgtcccaattggagggtataattccagctttg
gagtcttctcacgctatttatggtggtgttgagttggctaagactatgccaaaggatcaa
cacattgttatcaatgtttcaggacgtggtgacaaggatgtgcaaagtgttgccgaagtt
ttaccgaagttaggcgagcagattggctgggacttgagattcgaagccgatcctacgaag
taa

DBGET integrated database retrieval system