KEGG   Scheffersomyces stipitis: PICST_69669Help
Entry
PICST_69669       CDS       T01023                                 

Gene name
TRP5
Definition
tryptophan synthetase (EC:4.2.1.20)
Orthology
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
pic  Scheffersomyces stipitis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PICST_69669 (TRP5)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PICST_69669 (TRP5)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PICST_69669 (TRP5)
Enzymes [BR:pic01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PICST_69669 (TRP5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 700 aa AA seqDB search
MSALLKETFARCKKEGRNALVNFITAGYPTIEDTVPILKSMQDAGVDIIELGIPFSDPIA
DGPTIQAANNVALDNGITVPKCLDLVKQAREQGVTVPIILMGYYNPILKYGEIKLIEDSA
RVGANGFIVVDLPPEEAIKFRSSCARYGLSYVPLVAPATTDERLKVLGEIADSFIYVVSK
MGTTGASKSVSSGITELCARVRKFAGSTPIAVGFGVSTREHFLTVGESADGVVIGSRIVT
LIGESKPGERGVTAYKYVKSILGEGFSVNAPTSFSRAVVIDGTETKPVLEEDHKFNPKFG
EFGGQYVPEALHTCLAELEKGFESAVADPEFWKEFKDLYSYIGRPSSLHRAERLTEYAGG
AQIWLKREDLNHTGSHKINNALAQVLIAKRLGKKKIIAETGAGQHGVATATACAKFGLEC
TVFMGAEDVRRQALNVFRMRILGAKVVAVTNGTQTLRDATSEAFRFWVSNLESTHYVVGS
AIGPHPYPTLVRTFQSVIGQETKEQFKTLNGGKLPNAVVACVGGGSNSTGMFSPFEHDTE
VKMLGVEAGGDGLDTDRHSATLTAGIPGVFHGVKTYVLQDSDGQVHDTHSVSAGLDYPGV
GPELAFWKSTGRADFVAATDAQALIGFKLLSQLEGIIPALESSHAIYGGVELAKTMPKDQ
HIVINVSGRGDKDVQSVAEVLPKLGEQIGWDLRFEADPTK
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctttattgaaagaaacttttgctaggtgtaaaaaagagggacgaaatgctttg
gtcaacttcattactgctggttaccctactattgaggacacagttccaatcttgaagagc
atgcaagatgccggtgtagacatcattgaattgggtatcccattctccgacccaattgct
gatggtccaaccatccaagctgctaataatgtcgcgttggacaacggaatcaccgtccca
aagtgcttggacttggtcaagcaagcaagagaacaaggtgtcactgttccaatcatattg
atgggttactacaatccaatcttaaagtacggtgaaatcaagttgattgaggactctgca
agggtaggtgctaacggtttcattgtcgtcgacttgcctcctgaggaagccatcaagttc
agatcgtcttgtgcacgttatggattgtcttatgttcctttggttgcccctgccactact
gatgaaagattgaaggtcttgggagaaatcgcagattcctttatctacgtagtttctaag
atgggtaccactggtgcttccaaatctgtttcttccggtatcactgagttgtgtgctaga
gttagaaaatttgccggctctaccccaattgccgtaggtttcggtgtgtctacaagagag
catttcttaactgttggtgagagcgctgatggtgtggttattggttctagaatcgtgacc
ttaattggtgaatctaagccaggtgaaagaggtgtgaccgcttacaagtatgtcaaatcc
attttaggtgaaggcttttccgtcaatgcgccaacttctttctctcgggctgtagttata
gatggaactgaaactaagccagttcttgaagaggaccacaagttcaacccaaaatttggt
gaatttggtggtcaatatgttcctgaagcattgcacacttgtttggctgaattggagaaa
ggatttgaaagcgcagttgctgatcccgagttctggaaggaattcaaggacttgtactct
tacattggaagaccatcttctttgcatagggccgaaagattgactgaatatgccggaggc
gctcagatctggttgaagagagaagatttgaaccatactggttctcacaagatcaacaat
gccttggctcaagtgttaattgctaagagattaggtaagaagaagattattgctgagact
ggtgctggtcagcatggtgttgctactgctactgcatgtgctaagtttggattggaatgt
accgttttcatgggagccgaagatgtaagacgtcaagccttgaatgtgttcagaatgaga
atcttgggtgcaaaggttgttgctgtcactaatggtacccaaacattgagagatgcgact
tctgaagccttcagattctgggtatcaaacttagagtcaacgcactatgttgtcggttca
gcaattggaccacatccatacccaaccttggttagaaccttccaaagtgttattggtcaa
gaaaccaaagagcagtttaagactttaaacggcggtaagttaccaaacgccgttgttgct
tgtgtcggcggtggttcgaactccactggtatgttctctccttttgaacacgatactgaa
gtcaaaatgttaggtgtcgaagctggtggtgacggcttagacactgatcgccattctgca
actttgacggcaggtattccaggtgtgttccatggtgtcaaaacttacgttcttcaggac
agtgatggacaggttcatgacactcattcagtttctgcgggtttagactatcctggcgta
ggtccagaattggcattttggaagagcactggtcgtgctgacttcgttgctgctacagat
gctcaggcattgatcggatttaaattattgtcccaattggagggtataattccagctttg
gagtcttctcacgctatttatggtggtgttgagttggctaagactatgccaaaggatcaa
cacattgttatcaatgtttcaggacgtggtgacaaggatgtgcaaagtgttgccgaagtt
ttaccgaagttaggcgagcagattggctgggacttgagattcgaagccgatcctacgaag
taa

DBGET integrated database retrieval system