KEGG   Scheffersomyces stipitis: PICST_69820Help
Entry
PICST_69820       CDS       T01023                                 

Definition
hypothetical protein
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
pic  Scheffersomyces stipitis
Brite
Enzymes [BR:pic01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PICST_69820
Peptidases [BR:pic01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PICST_69820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 1340 aa AA seqDB search
MSDDTPAATALSSSSSSDSVNLSTNSPYKIPNSTDNLKSDSESLLETELMEKRHLIEELI
HNSNTGKEGDPWYLISTEYLNNFLHLPATSFEDLQSKLGPVDNTSIVDQNGILYPENNEP
VETYNVSPEIFNYLADWFGTKGQPVCRCLIINPETGAKEVERFPPVFHIHQLGKRPVQNS
YYTRHHNHPTHATSHPTAVSLSRTKTFTDLLDLIRVSVLKLPKRPIDNFRIWFIESKNIA
EYTSTLTISNLIFDIDNKSLVHSGILKDTLKSQGIKSDAFHILVEVKDAKASHDRFPVNT
YLNQIDVEQYDFDKLSSKSSGHLGLSNLGNTCYMNSALQCLLHVAEVNYYFLYNLYKREL
NFDNPLGNHGDIANAFGNLLKQAFDPSSSKDSSITPREFKSTIGRYSSMFSGYMQQDSQE
FLSWLLDALHEDLNRIHKKPYCEKPELKDEEINDPKAIIKLSETCWNQHKMRNDSVITDL
FTGLYQSTLLCPDCSKTSITFDPFNDLTLPLPISKKWYHTFTIVDLSDGGILRGTRIMKL
EVELNKTSNFDDLLTYLSDFLKVETTHLFLYEIFRNSFYSDFQLDYNRNKFMPISDIVRD
SDEVHVYYVPYNPETDIIIPVYNTVEDPDKSYKVTETFGIPLFVTLNKESDVYSFGTIRQ
KLLDKVSILSKLDLNEEYNKIKNDTESYVEKKHYGPKDFPLLCKQDDNAVLVEKPPSDHT
IEGDGQLDEEDEDGYISDISLANPFISADFGFTIKSLNGYSHKPHANFRNRYNFARNAPK
TVTPPRVINVPLHKPTFNEFKPLSDQLPELKKDFYHYPTYDKKFNKEMEDLAEEVQNDLI
ASASDDTSKSNDDYEFVMLDAEGGEEATKNGSVQPPALPPRNLIPQMNSSDEDTEGEQNL
GSLFDSTSTLPIPPPSSGYAESLKPSNENSPTNTPSEVELGNHPELITKDTILLCDWDYP
IFEQCFVENQTWENIPVLPNPELEKNRAKIERQRKSKISLYDCLKSFSTPEILGEHDLWY
CPRCKDHKRATKTIQVWSTGDILTIHLKRFHSARAFSDKIEMVVDFPIEGLDMSSYIANP
EAENSLYDLIAVDNHYGGLGGGHYTASVKNFRDGNWYYFNDSRVTSINNPEEVITSAAYL
LFYRKRTTDPDDYLGGGDLNNMIRSGHELYKKSLITKKASYDLVQQQVEKYTKHEEQIKR
EMELDRELEKRKLQESGSIEAPENGEETVYEDGEAASPNNSKSADNEPVSARKTRSFTNT
KDSPNDSVTTSAKAKFKFDNDEDDYDYEDDSDNIRKQRLLSKENNNNKLVQIKSNGKQEV
ASSPIAMEAEYDSMGEDCSV
NT seq 4023 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacgacactcctgctgccaccgcactttcgtcgtcgtcgtcgtcggactcagtg
aacctctccaccaactctccctacaagatccccaactccactgataacttgaagctggac
tccgagtcgctcttggaaactgaattgatggagaagcgccacttgatagaggaattgatc
cacaacagcaatacaggcaaagagggcgacccctggtacctaatctcgacagagtacctc
aacaacttcctccacctcccggcaacatcttttgaagacctccaatccaaacttggtccc
gtagacaacacctccattgtagaccagaatggcatcttgtacccggaaaacaacgaacca
gtcgaaacatacaacgtctcaccagaaatcttcaactatcttgccgactggtttggcacc
aaagggcagcctgtgtgtagatgtcttataatcaaccccgaaactggtgccaaagaagtc
gaaagatttcctcctgtcttccatatccaccaattgggcaaaagacccgtgcagaactcg
tactatactcgccaccataaccatcctactcatgctaccagccatcccacagctgtatct
ttgtctcggactaagacattcaccgatttgctcgacttgatccgggtatcggtgttgaag
ttgcccaaaagacccatcgataacttccgtatctggttcatcgaatcaaaaaacatagcc
gaatacacttctactcttactatcagtaatctcatctttgacatcgacaacaaaagtttg
gtccatctgggcatcttgaaagatactctcaagagccagggcattaaatccgacgctttc
catatcctcgtagaggtgaaggatgcaaaggccagccatgaccgcttcccagtgaacaca
tacttaaaccaaatagatgtggaacagtacgacttcgacaagcttagtagtaagagcagc
gggcatttgggcttaagcaacttaggaaatacatgttacatgaattcagctttgcaatgc
ttgttacatgtggcagaagtaaactactatttcttgtacaatctatacaaacgagaattg
aactttgacaatcctttgggtaaccacggagatatagccaatgcttttggaaacttgctt
aaacaggcttttgacccttcctcgtcaaaggactctagcatcacacccagagaattcaaa
tccaccataggaaggtactcgtccatgttttccggctacatgcaacaagattctcaagaa
tttctaagctggctcttggatgctcttcatgaggatctcaacagaattcataaaaagccc
tactgcgaaaagccggagttgaaagacgaagaaatcaacgatcccaaagccattattaaa
ttgtctgaaacttgctggaaccagcacaagatgagaaatgattcggtgattacagatttg
tttaccggcttatatcagtcgactttgctttgtccagattgttcaaagacctctataaca
ttcgatccgttcaacgatttgacgttaccattgccaataagcaagaagtggtatcacaca
ttcactattgttgatttgtcggatggcggcatcttaagaggaacgagaataatgaagttg
gaagttgagcttaacaagacgtccaatttcgacgatttattgacttatttgagtgatttc
ttaaaagtcgagactacccacttgttcctctacgagatatttagaaattcattctacagc
gactttcaattggattacaaccgaaacaagtttatgcccattagtgacatcgtgagagat
tcagatgaagtacatgtctattacgtcccttacaacccagaaacggacattataattcca
gtttacaatacagttgaggatccagacaagtcctacaaagttacagaaacttttggaatc
ccgttgtttgtgacattgaacaaagaaagtgatgtatacagttttggaacaatccgtcaa
aagcttttggataaggtttctattctttctaaacttgacttgaacgaagaatataacaaa
atcaagaatgacacagagagctacgtcgaaaagaaacattatggacctaaagattttcct
ttactttgcaagcaggatgacaatgcagtattggtagaaaagcctccaagtgatcataca
attgaaggtgatggacaacttgacgaagaagacgaagatggatacatatctgatatttct
ttggccaatccttttatcagcgcagattttggtttcacaattaagtctttaaacggatat
agccacaaaccgcatgcaaactttcgtaatagatacaactttgctagaaatgcgcccaag
acagtcacgccacctcgtgtgataaatgttccacttcacaagcctactttcaatgaattc
aagcctttgtcagaccaattgccagaacttaagaaagatttctatcattatccaacgtac
gacaagaagttcaacaaagaaatggaggacttggcagaagaagtgcagaatgatttgata
gctagtgctagtgatgatacatccaagtccaacgatgactatgaatttgtaatgcttgat
gctgaaggaggagaagaagctacgaagaatggcagtgtccagccaccagcgctacctccc
agaaatttaattccacagatgaatctgtcggatgaagacacagaaggggagcagaattta
ggaagcttattcgattccacatctactttgccaattccacctccttcttcgggttatgct
gaatcgttgaaaccatccaatgaaaattctcctacaaatactccatcagaggttgagctt
ggtaatcatccggagttgataaccaaggatacaatcttactctgtgattgggattacccg
atttttgaacaatgttttgtcgagaatcaaacttgggagaatattccagtacttcccaac
ccagaattggagaagaatagagccaaaattgaaagacagagaaagtctaagatttcacta
tatgactgcttgaagagtttcagtactccagagattctcggtgaacacgatttatggtat
tgtcctagatgtaaagatcataaacgcgctactaaaaccattcaagtttggtcaactggt
gatatattaactatccacttgaagaggttccatagtgccagagcttttagtgacaagatt
gaaatggttgttgacttccctatagagggacttgatatgagttcatacattgctaatcca
gaagctgagaatagtctttatgacttgattgcagtggataaccactatggtggcttaggt
ggtggtcactatactgcttcagttaaaaacttccgtgatggaaattggtactatttcaac
gatagtcgcgttaccagtatcaacaatccagaagaagttattactagtgcagcctactta
ttattctaccgcaagaggactacagatccagacgactaccttggcggcggagacttgaat
aatatgatacggagcgggcatgagttgtacaagaagtcgttaatcaccaagaaagccagc
tatgatttagtacaacagcaggtcgaaaaatacactaaacacgaggaacagatcaagcga
gaaatggaattagatcgtgaattagaaaaaaggaaattacaggaactggggctgatagaa
gccccagaaaatggagaggaaactgtctatgaggatggtgaagctgcttcccccaacaat
tccaaaagtgcagataatgaacctgtaagtgcaagaaagactagatcatttaccaatacc
aaagattcgcctaatgattctgtcacaacttctgccaaggctaagttcaagtttgacaac
gacgaagacgactacgactacgaagacgacctggataacataagaaaacagcgacttctt
tctaaggagaacaataacaacaagttggtgcaaattaaaagcaacggcaagcaagaagtg
gcatcgtcgcctattgccatggaagcagagtacgatagtatgggcgaagactgctcagtc
taa

DBGET integrated database retrieval system