KEGG   Scheffersomyces stipitis: PICST_70108Help
Entry
PICST_70108       CDS       T01023                                 

Gene name
ALA2
Definition
(RefSeq) alanine transaminase (ALAM)
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
pic  Scheffersomyces stipitis
Pathway
pic00220  Arginine biosynthesis
pic00250  Alanine, aspartate and glutamate metabolism
pic01100  Metabolic pathways
pic01200  Carbon metabolism
pic01210  2-Oxocarboxylic acid metabolism
pic01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PICST_70108 (ALA2)
   00220 Arginine biosynthesis
    PICST_70108 (ALA2)
Enzymes [BR:pic01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     PICST_70108 (ALA2)
Amino acid related enzymes [BR:pic01007]
 Aminotransferase (transaminase)
  Class I
   PICST_70108 (ALA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 4837335
NCBI-ProteinID: XP_001382582
JGI: 70108
UniProt: A3LPT6
Position
2
AA seq 509 aa AA seqDB search
MLAIRTTMKQSQPRFFVSLKVSYSTFKPAAPLSIKDINPQTVQAKYAVRGKIPIIADELR
DLIKKNPQSHGLPFSKIINANIGNPQQLDQRPLTWYRQVLSILQYPALAEAVDYPQDVKD
RAAVILENIGSIGAYSHSQGAPYIRESIAKFIEKRDGGYAANPNNIFLTSGASSAVSYLL
QILSSDENSGFLIPIPQYPLYTATIALNNAIPIGYFLDEANHWSTNPEQIRQIILENKQK
GVNIKALVVINPGNPTGSILSEQDIIELIDIAAEHGIVLIADEVYQENVFKGKFLSMKKV
LYELLEQEPEVYKNVQLASLHSTSKGVSGECGQRGGYMELVGFSTEVKDIVFKLASINLC
SVVSGQALMELMINPPQEGDPSYELYNAETSSIHNDLEIRADMLYRAFLQMEDIQCNKPT
GAMYIFPTLDFSPEKYHKLFMRAEQSDLQPDDIYCIELLESTGICCVPGNGFGQVPGTFH
LRTTFLPPGQEWIDRWLTFHETFVKKYTS
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgttagccattagaacaactatgaaacagagccagcctcgcttctttgtctcattaaag
gtctcctactccaccttcaagccggccgcccctctttccatcaaagacatcaacccacaa
actgtccaggctaaatatgctgttcgtggtaaaattccaattattgccgacgagctccgt
gatctcattaaaaagaatccacaatcgcacggcttgcccttttccaaaatcatcaatgcc
aacatcgggaacccgcagcaattagaccaaagaccattaacttggtatagacaagtcctt
tccatcttgcagtaccctgctttagccgaagcagttgactatccccaagatgtcaaggat
agggccgccgtcatcttagagaatatcggctctattggtgcctattcacactcacagggt
gctccttacatccgtgagtcgattgccaagttcatcgaaaaaagagacggtggctacgct
gctaaccctaacaacattttcttgacatcgggagcctcttcagccgtgtcgtacttgtta
cagatcttgtcatcggacgaaaactccggtttcttgatcccaattccacaatacccattg
tacacggctactattgcactcaacaatgcaattcctatcggttactttttggacgaagcc
aaccactggtctactaaccctgaacaaatcagacagatcattcttgaaaacaaacagaag
ggagtcaacatcaaggcacttgtagtcattaacccgggcaaccctacaggctcaatcttg
tccgaacaggacattattgaattaattgacatcgccgcagaacacggtatagtccttatt
gccgacgaagtttaccaggagaatgtgttcaagggtaagttcctctcgatgaagaaggtt
ttgtacgagttacttgaacaggaaccagaagtatacaagaatgtgcaattggcttcgttg
cattcgacttctaagggtgtttccggcgagtgtggtcaaagaggtggatatatggaactt
gtaggcttcagcactgaagttaaagatatagttttcaagttggcatccatcaatttgtgt
tcagtagtttctggacaagcattgatggagttgatgatcaaccctcctcaggaaggcgat
ccatcttacgaattgtacaatgctgaaacctcctctatccacaatgacttggaaatcaga
gctgatatgttgtatcgtgccttcttgcaaatggaagacatccaatgtaacaagcctact
ggtgccatgtacatcttccctacgttggacttttcaccagaaaagtaccacaagctcttc
atgagagccgagcaatcggatttgcaaccagacgacatctactgtattgagcttctcgag
tccacaggaatctgctgtgttccaggtaacggtttcggacaggttccaggaaccttccac
ttgagaaccactttccttcctcctggccaagaatggatcgacagatggttgactttccac
gagacgtttgtcaagaagtacacttcttga

DBGET integrated database retrieval system