KEGG   Scheffersomyces stipitis: PICST_70266Help
Entry
PICST_70266       CDS       T01023                                 

Definition
hypothetical protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
pic  Scheffersomyces stipitis
Pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:pic00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    PICST_70266
Enzymes [BR:pic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     PICST_70266
Protein kinases [BR:pic01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   PICST_70266
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 384 aa AA seqDB search
MTSMENTETSIRSLNDINLEEMAQKQQQQNIYVTPPVLENQKTASQLSLSKKSSKHSNRD
TTTRGKYTLNDFQILRTLGTGSFGRVHLTRSIHNGRFYAMKTLKKEIVVNMKQVEHTNDE
RRMLKLAQHPFIIRMWGSFQDCHNLFMIMDYIEGGELFSLLRKSQRFPTPVAKFYAAEVF
LAIEYLHKLDIIYRDLKPENILLDKNGHIKLTDFGFAKEVTDVTYTLCGTPDYIAPEVVA
TKPYNKSVDWWSFGILIFEMLTGYTPFYDPTPMKTYENILNGTITYPDYLPPDILDLLQK
LIVKDLTQRLGNLQGGSDDVKNHPWFKEVIWERLLSRDIETPYEPPITSGVGDTSQFDRY
PEDKDLDYGISGVEDPYGSLFNDF
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcaatggaaaacacagagaccagcattagatctctcaacgatatcaacctcgaa
gagatggcgcagaaacaacaacaacaaaacatatacgttacgccaccagttctagagaac
cagaagacagcgtcacagctaagtttatccaagaaaagctctaaacattccaaccgtgac
actacgacacgcgggaaatacacgttgaacgactttcagatactaagaacattgggaaca
gggtcgtttgggagagtgcatttgactagatccatccataacggaagattctacgccatg
aaaacgttgaagaaggaaatagtggtgaatatgaaacaggtggaacacacaaacgacgaa
agaagaatgttgaaattagcccagcatccgtttatcatcagaatgtggggcagcttccaa
gactgtcacaacttgttcatgatcatggattacatagaaggaggagagttgttctcgttg
ttgagaaagtctcaacggttcccgactcccgtagccaaattctacgctgctgaagtgttc
ttggccatcgaatatttgcacaagttggatatcatctatcgtgacttgaagccagaaaac
atcttgttggacaagaatggccacatcaagttgacagactttggtttcgctaaggaggtg
acagatgtaacctacaccttgtgtggaactccagattatattgctccagaagtagttgct
actaagccatacaataagtcagtggactggtggtcattcggtattttaatatttgaaatg
ttgaccggatacactccattctacgatccgacccctatgaagacttacgaaaacatcctt
aacggtaccatcacctaccctgactacttacctccagatatcttggatcttttacagaag
ttgatcgtcaaggatttgactcaacgtttgggtaacttacagggaggttctgatgatgtg
aaaaaccatccatggttcaaagaagtgatttgggaaagattattatcaagagatatagaa
acaccgtacgagcctccaatcacttctggtgtgggagacacatcccagttcgatagatat
ccagaggataaagatctcgactatggaatcagcggagtagaagatccatatggcctgctc
ttcaatgacttttaa

DBGET integrated database retrieval system