KEGG   Scheffersomyces stipitis: PICST_70693Help
Entry
PICST_70693       CDS       T01023                                 

Gene name
OLE1
Definition
stearoyl-CoA desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
pic  Scheffersomyces stipitis
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    PICST_70693 (OLE1)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PICST_70693 (OLE1)
Enzymes [BR:pic01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     PICST_70693 (OLE1)
Lipid biosynthesis proteins [BR:pic01004]
 Desaturase
  First
   PICST_70693 (OLE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 484 aa AA seqDB search
MTEQLDTADITALNALAAGTNKKTPRIVAAGLGGRLMGTAEMVKVTAEQITEDSLESLAD
KDAREKAKYAKTKHISELPWTFGNFYKKINWLNMILVVAMPAFGTYQAVFYPPALKTLIL
AFVLYLFSGLSITAGYHRLFSHRAYDAATPVKLFFAFFGAGAVEGSIKWWGHSHRVHHRY
TDTDRDPYDARQGFWYSHMGWMLTKANPKNRARADISDLSTDWIVTFQHRHYLLMMLVSA
FVVPTLTAGLFWGDYWGGFIYGGILKSFFIQQVTFCINSLAHWIGVQPFDDRRTPRDHAL
TAVFTFGEGYHNFHHEFPSDYRNALKWYQYDPTKIVIWVLSKLGLAWNLKKFSQNAIEQG
LVQQQQKKLDRMKAKLNWGLSVDELPVWDREEFNAKAKSDGLIIISGIIHNVKNFVKEHP
GGQALVRASLGKDATKAFNGAVYAHSNAAHNLLASMRVAVIRDGNVNANTFDLQQQFLDK
EKLN
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagcaattggacaccgcggacatcaccgccctcaatgcattggctgccggtacc
aacaaaaagactcccagaatcgtggctgctgggttgggaggcagattgatgggtaccgcc
gaaatggtcaaagtgactgccgaacagatcacagaggactccttggaatccttggccgac
aaggacgcccgtgaaaaggcaaagtatgccaagaccaagcacatctccgaattgccatgg
acttttggaaacttctacaagaagatcaactggttgaacatgattttggtcgttgccatg
ccagccttcggtacctaccaggctgtcttctaccctccagctttgaagaccttgattctt
gccttcgtgctctacctcttctctggtctttccatcacagctggctaccatcgtttattt
tcccacagagcctatgacgccgccactccagtcaagctcttctttgccttctttggtgct
ggtgccgtcgagggttccatcaaatggtggggccactcgcacagagtccaccacagatac
accgataccgacagagacccttatgatgccagacaaggtttctggtactcgcacatggga
tggatgttgaccaaggctaacccaaagaacagagctagagccgacatctctgacttgtcc
accgactggatcgtcacattccagcaccgtcactacttgttgatgatgcttgtctcggcc
tttgtagttcctaccttgactgctggtctcttctggggcgattactggggtggtttcatc
tacggaggcattttgaagtctttcttcatccaacaagttactttctgtatcaactctttg
gcccactggatcggtgttcagccatttgacgacagaagaactccaagagatcacgcattg
actgctgtgttcactttcggtgaaggttaccacaacttccaccacgagttcccatctgac
tacagaaacgctcttaagtggtaccaatacgatcctaccaagatcgttatctgggtctta
tccaagcttggccttgcctggaacttgaagaagttctcgcagaacgccattgaacaaggt
ttggttcaacaacaacagaagaagttggacagaatgaaggccaagctcaactggggtctt
tccgtcgacgagttgccagtgtgggacagagaagagttcaacgccaaggcaaaatccgac
ggtcttatcatcatctctggtatcatccacaatgtcaagaacttcgtcaaggaacaccca
ggtggacaagctttggtcagagcttcattgggtaaggatgccactaaggctttcaatggt
gctgtctatgctcactccaacgctgctcacaacttgttggcttcgatgagagtggccgtg
ataagagacggaaacgtaaacgccaacacttttgatcttcaacaacagttcttggacaag
gaaaagcttaactag

DBGET integrated database retrieval system