KEGG   Scheffersomyces stipitis: PICST_72214Help
Entry
PICST_72214       CDS       T01023                                 

Definition
hypothetical protein
Orthology
K04646  
clathrin heavy chain
Organism
pic  Scheffersomyces stipitis
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:pic00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    PICST_72214
Exosome [BR:pic04147]
 Exosomal proteins
  Proteins found in most exosomes
   PICST_72214
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 1668 aa AA seqDB search
MSNDIPIDFTELTQLTSLGIQQSSLDSKSTTLESDHYVCVRESGPSGNTVAIIDLKNNNE
VTRKNMSADNAILHPSQFVISLRANGTTLQIFNLGTKQKLKSFSLAEPVVFWKWISDEYL
GLVTGSSIYYWNIFDGTDNGPVKLSERHDSLNNSQIINFVAEPSLNWFAVTGLAQENGRV
AGHIQLYSKTRNVSQAIEGHVSKFASIRLTGAAAPTKVFCVGNKNAQGQGNLHIIEIDHV
DGNPPFQKKSVDIFFPPDAANDFPISLQASDTYGIIYVLTKYGFIHLYDMETGSNLFVNR
ITADPVFTAASYNNGTGIITINRSGQVLSVEVSKDKIIPYVLEKLSNVPLALALASRGGF
PGAENLFQQQFQNLLNQGDYTNAAKVAASSEQLRTQDTINKLKHITPQPGQISPLLQYFS
TLLDRGTLNKYESIELAKPVLQQDRKPLFEKWLKEEKLTCSEELGDIVKSYNDTALALAV
YIRANVNIKVVSSLAELGQFDKIIPYCEKVGYNPDYTNLIQNLVRVNPDKASEFATSLLA
RPDIQINAENIADLFFSQNYIQQGTAFLLDYLKNDAPSEGHLQTKVLEINLLHAPQVADA
ILGNQMFSHYDKPTIGKLCEKSGLFQRALEHYDDLKDIKRVIVHTNVLANDWLVSYFGQL
NVQQSVACLKELLGSNMQQNLQVVIQVATKYSDLIGPLTLIKIFEDYKCTEGEYYYLSSI
VNLTQEPDVVFKYIQAAAKMNQTKEIERVVRDNNVYNGEKVKNFLKEFKLDDQLPLIIVC
DRFNYVHDLILFLYKNQYFKFIEVYVQSVNPANTPQVVAGLLDVDCDEAIIKNLLLTVLG
RVPIKELVAEVEKRNRLKILLPFLEKTLEGGSNDQEVYNTLAKIYIDSNNSPEKFLQENN
NYDTLAVGKYCEKRDPYLAYIAYSKGGNDDELINITNENKMYKYQARYLLAKSDFDLWNS
VLVEGNVHRRQLVDQVISTGIPELNDPEPISITVKAFMENDLPQELIELLEKIILEPSPF
NDNTSLQGLLILTAIKADPSKVSNYIEKLDKFDPVEIAPLCIDNQLYEEAFQVYDKFELR
SDAMKVLVEDIMSLDRGEQYAEKYDTSELWYQLGTAQLNGLRIPEAIDSYVKSKNPENFE
QVIEIAEHAGKEEELVKFLDMARETLREPVIDGALINSYATLDKLSEIEKFVGGTNVADL
ESIGDKLFEAKNYKAAKILYSNISKYSKLATTLVYLEDYQGAVDCARKASNTNVWKQVNS
ACIENKEFRLAQICGLNLIIDAEELPELVQTYEHNGYFNELIALFESGLGLERAHMGMFT
ELATLYAKYSPEKVMEHLKLFWSRINIPKVLTACEEAHLYPELIFLYCHYEEWDNAALTM
IERSEVAFDHASFKEIIVKAPNLEIYYKAIQFYINENPSLLVDLLSVLTPKLDLPRVVRI
FVKTDNLPLIKPFLISVLEKNNSVVNSAYHDLLIEEEDYKSLRSSIENETNNRFNKLDLA
ERLENHDLVFFRQISATLFTKEKKFNKAISILKNDKLWPDLIRTVAISKSQKIAHEALDY
FVETGNHECFVALLFTSYDYISYDYVLELSWLHNLGNFIKPYEISIVHENQKRINEVYED
LKKRREAAKQEEEQPTIAQPLMITNGSIGANVTGLGYQATGVGFGNAF
NT seq 5007 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacgatatccctattgacttcacggagttgacccagttgaccctgctaggcatc
cagcagagctcgctagactccaagtcgaccaccttggaatcggaccactatgtctgtgtt
cgtgagtctgggccctctggaaacaccgtggccatcattgacttgaaaaacaacaacgaa
gtcacaagaaagaacatgtctgctgacaatgccatcttgcaccccagccaatttgtcatt
tccttgagagccaacggcaccacgttgcaaatcttcaacttgggcaccaaacagaagttg
aagtcattttccttggctgagcctgttgtgttctggaagtggatctctgatgagtacttg
gggttggtaacaggcagctccatctactactggaacatctttgacggcactgataacgga
cccgtcaagttgtcagagagacacgattcgttgaacaacagtcaaatcataaatttcgta
gccgagcctagcttaaactggtttgccgtgactggtctcgctcaggaaaacggtcgtgtc
gctggtcacatccagttgtactccaagactagaaacgtttcgcaagccattgaaggtcat
gtttccaagtttgcctcgatcagattaaccggtgctgctgctcctaccaaggtgttctgc
gtaggtaacaagaacgctcaaggtcaaggtaacttgcatatcatcgagatcgaccatgta
gacggaaatccacccttccagaagaagagtgtagatattttctttcctccagatgccgct
aacgatttccccatcagtttgcaagcttctgacacttatggtatcatctacgtgttgacc
aaatatggtttcatccacttgtacgacatggaaactggctccaacttgttcgtcaacaga
atcacggccgatccagtgtttactgctgcttcctacaacaatggaaccggtataatcacc
ataaacagatcgggtcaggtgttgagtgtagaagtttcaaaggacaagatcattccttat
gtcttggaaaagttgtctaatgtacctttagctttggctttagcttctcgtggcggcttc
cctggtgctgagaacttgttccagcaacagttccagaacttattgaaccagggcgattac
accaatgctgccaaggttgctgcttcttccgaacaattgcgtacccaagacactatcaac
aagttgaagcacataacacctcaaccgggccagatctcgcctctcttgcaatacttctca
acattgttggacagaggtaccttgaacaagtacgagtccatcgagttggccaaacccgtg
ttgcaacaggatagaaagccattgtttgagaagtggttgaaggaagagaagttgacctgt
tctgaagagttgggtgatattgtcaagtcctacaatgacactgccttggctttggctgtg
tacatcagagccaacgttaacatcaaggtcgtatcctctttggctgagttgggccagttc
gacaagatcattccctactgtgaaaaggttggctacaaccctgactacactaacttgatc
cagaacttggttagagtcaacccagacaaggctagcgagtttgctacctctttattggcc
aggccagacatccaaatcaatgctgaaaacattgctgatttgttcttctctcagaattac
attcaacagggtacagccttcttgttggactacttgaagaacgacgctccttctgagggc
catttgcagaccaaggtgttggaaattaacttgttgcatgccccacaagtagctgatgcc
atcttgggtaaccagatgttcagccactacgacaagcccaccattggtaagttgtgcgag
aagtccggtttgttccagagagctttggaacactatgatgacttaaaggatataaagaga
gtcattgtccacacgaatgttttggccaacgactggcttgtatcttactttggccaattg
aacgttcaacagtctgttgcttgtttgaaggagttgttgggaagcaacatgcaacagaac
ttgcaagttgtgatccaagttgccaccaagtactctgatttgattggtcccttgactttg
atcaagatctttgaagactacaagtgtactgaaggtgaatattactatttgtcttcaatt
gtcaacttgacccaagaacccgatgttgttttcaagtacatccaggctgctgctaaaatg
aaccagacaaaggaaattgaaagagttgtcagagacaacaatgtttacaacggtgaaaag
gtcaagaacttcttaaaggaattcaaattggacgaccagttgcctttgatcattgtttgt
gacagatttaactatgtccatgatttgattttgttcttgtacaagaatcagtacttcaag
ttcattgaggtctacgttcagtcggtcaacccagccaacaccccacaggttgttgctggt
ttgttggatgttgactgtgacgaagctataatcaagaacttgttattgactgtcttagga
agagttcctatcaaggagttggtagctgaagttgaaaagagaaacagactcaagatattg
ttgcccttcttggagaagactttggagggaggttccaacgatcaggaagtctacaacact
ttggctaagatctatatcgattctaacaactctccggagaagtttttgcaagaaaacaac
aactacgacactttggctgttggtaagtactgtgaaaagagagatccctacttggcttac
atagcttactccaagggtggtaacgatgatgagttgatcaacatcaccaacgagaacaag
atgtacaaataccaagccagatacttattggcaaagtctgactttgacttgtggaattct
gttttggtagagggcaacgttcacagaagacagttggtagaccaagtcatctcaaccggt
attcctgaattgaatgatcctgaacctatctcgatcaccgttaaggctttcatggaaaac
gatttacctcaagaattgattgagttgttagaaaagattattcttgagccatctcctttc
aatgacaacacctccttgcaaggattattgatcttgactgctatcaaggctgacccatcc
aaggtttctaactatattgagaagttggacaagtttgatccagtcgagattgctccattg
tgtattgacaaccagttgtatgaagaagcctttcaggtctacgacaagtttgaattgaga
tctgatgccatgaaggttttggttgaagacatcatgtccttggacagaggtgagcagtac
gctgaaaagtacgatacttctgaattgtggtatcaattgggtactgctcaattaaacggt
ttgagaattccagaagctatcgattcttatgttaagtctaagaacccagaaaactttgaa
caagttattgaaatcgctgaacatgctggtaaagaagaagagttagtcaagttcttggat
atggccagagaaactttgagagaaccagtcattgatggtgctttgattaactcttatgct
actttggacaagttgagcgagattgaaaagtttgttggtggaaccaatgtcgctgacttg
gaatctattggtgacaagttattcgaagctaagaactacaaagctgctaagatcttgtat
tccaacatctccaagtactccaagcttgcaaccactttggtttacttggaagactaccaa
ggagctgttgactgtgctagaaaggcatccaacactaatgtttggaaacaggtcaactct
gcctgtattgaaaacaaggagttcaggttggctcaaatttgtggtttgaatttgattatc
gatgccgaagaattgcctgaattggtacagacttatgagcacaacggctactttaatgag
ttgattgcacttttcgaaagtggtttaggtttggaaagagcccatatgggtatgttcact
gaattggctaccttatatgcgaaatatagccctgaaaaggttatggaacacttaaaattg
ttctggtccagaatcaacattccaaaagtgttgactgcgtgcgaggaggcccacttgtac
cctgaattaattttcttgtactgccattacgaagaatgggacaatgctgctttgactatg
attgaaagatccgaagttgcttttgatcatgcttcctttaaagaaatcattgtcaaggct
cctaacttggaaatctactacaaggctattcagttctacattaatgaaaacccatctttg
ttagttgacttgttgtctgttttgacaccaaagttggacttgcctagagttgttagaatc
tttgttaagaccgacaacttgccattgatcaagccattcttgatctcggttttggaaaag
aacaactctgttgtcaactctgcttaccacgatttgttgattgaagaagaagattacaag
tcgttgagatcttctatcgaaaacgaaaccaacaacagattcaacaagttggacttggcc
gagagattggagaaccatgatctcgttttcttcagacagatttccgctactttgttcact
aaggaaaagaaattcaacaaggctatctctatcttgaagaacgacaagttgtggccggat
ttgattagaactgttgctatctcgaaatcccaaaagattgctcacgaagcattggactac
ttcgttgaaactggtaaccatgaatgttttgttgctttgttatttacctcttacgactac
atttcttacgactatgtgcttgaattatcgtggttgcataacttgggtaatttcatcaaa
ccatacgaaatttccattgtccacgaaaatcaaaagagaattaacgaagtatacgaagat
ttaaagaagagaagagaagccgccaagcaagaagaagagcaacccactattgctcaacca
ttgatgattaccaatggttccattggtgctaatgtcaccggcttgggctaccaagccaca
ggcgttggctttggaaacgctttttga

DBGET integrated database retrieval system