KEGG   Scheffersomyces stipitis: PICST_72313Help
Entry
PICST_72313       CDS       T01023                                 

Definition
hypothetical protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
pic  Scheffersomyces stipitis
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    PICST_72313
Enzymes [BR:pic01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     PICST_72313
Glycosyltransferases [BR:pic01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   PICST_72313
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 758 aa AA seqDB search
MSSTLRKRGPKKGQNAVGNSAAQEDDDLKKLRELEEEARGFKEPEYKYQVALAAITILAA
YTRFYHISIPDKVVFDEVHFGKFASYYLERTYFFDLHPPFAKLLIAFAGWLIRYDGAFKF
ENIGDSYITNKVPYIPLRALSAIQGTLTVPVMFLTMKTLGFSVAGCLFAALIVCFDNAHV
ADSRLILLDATLIFAVALTIYAYSKFSTYRKQPFSQKWWTWLTATGVSLSLVISTKYVGV
FTYVTIGIAVIHELWILLDYQKGLTIPEFSKHFAARLWSLIIMPFIIYLFWFYVHFAILT
KSGPGDNFMSAEFQETLLESPMAKLSKNVHYNDLITIKHKDTDAFLHSHLHSYPLRYEDG
RVSSNTQQVTCVFDPDSKEAEDVNNHWEIVPSSKDVARGTDVYTNDVVRFRHVGTGGYLL
AHDVASPLKATHEEFTIAYGEDAAVTKFNETLFRLRFGGSGSTKNKNKRRVIKTKGTPLR
IIHVDTVVAMWTHDDEVLPEWGFGHQEVSGNKKTQDSDNVWTIDDIVDMDPIDPRSKYVP
KQVKTLSFFKKWWELQGLMFKHNNQLSSEHPFASQPETWPLALSGVSFYNDNDNRRQIFF
TGNIIGFWLEVCFLSIYLGLLLADQVTRRRHVYILSDRARSKLYNTLGFLFAGWGAHFFP
FFLMNRQKFLHHYLPAHLLAALFSGGLVDFISSNNIRDSNGRPTVYNKIKSTVIVTGCSI
GIVWFFFYFRPITYGDTTLSVEEVKARQWLDIKLHYAK
NT seq 2277 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgactttaaggaaaagagggccaaaaaagggccagaacgccgttggcaattct
gctgcccaagaagatgacgacttaaagaagctccgcgagttggaagaagaagctcgtgga
ttcaaagagccagagtacaagtaccaagtagctcttgcagccatcaccatattggccgca
tacactcgtttctatcacattagcatacccgacaaagttgtgtttgacgaagtccatttc
ggtaagtttgcctcgtattacttggaaagaacgtacttctttgatttgcaccctcctttt
gccaagttgcttatagcctttgctggttggttgattcgttacgatggtgcctttaagttc
gagaacattggcgactcctacatcaccaacaaagtgccctacattcccttgagagcactt
ctggctattcagggtacgcttacagtacctgtgatgtttttgacaatgaagacgttggga
ttttctgttgctggctgtcttttcgcagctctcatagtctgtttcgacaatgcccatgta
gctgattctagattaattctcttggatgccactttgatcttcgctgttgccttgactatt
tatgcgtactccaagttcctgacatacagaaagcagcccttctcccagaagtggtggaca
tggttgacagctactggagtgagtttatctttggttatttctacaaaatatgtaggtgtg
ttcacttatgtgacgatcggcattgctgtaatccacgagttgtggattttgttggattat
cagaagggattgacaattcctgagttttcgaagcattttgcagccagattgtggtcattg
atcatcatgcccttcattatctacttgttctggttttacgtgcattttgccattttgacc
aaatctggccctggtgacaatttcatgtcagctgagttccaggaaactttgctcgaatcc
cctatggctaaattgtccaagaacgttcactataacgatcttatcaccataaaacataaa
gatactgacgctttcttgcactcgcatttacactcatatccattgcgttatgaggatgga
agagtctcgtccaatactcagcaggttacttgtgtttttgacccagacagcaaagaagcc
gaagacgtcaacaaccactgggaaattgttcctagctccaaagacgtcgcaagaggtact
gatgtgtacaccaacgatgttgtcaggttcaggcatgtaggaactggtgggtatttgctt
gcccatgatgttgcttccccattaaaagctacacatgaagagttcaccattgcttacggc
gaagacgctgctgtgaccaagttcaacgagactctcttcagattgagattcggtggatcc
ggttctaccaaaaacaaaaacaaaaggagagtcatcaagactaaaggtacaccattgcgt
attatccatgtagacaccgtagtggccatgtggacacacgacgatgaagtcttgccagaa
tggggttttggccatcaggaagtctctggtaacaaaaagacgcaagactctgacaacgtc
tggactatcgacgacattgtagacatggaccctatagatccaagatccaagtatgtaccc
aagcaagtcaagacgttgtcattctttaagaaatggtgggaattgcaaggattgatgttc
aagcacaacaatcagttgtcttctgaacacccttttgcatcacagcccgaaacctggcca
ttggctttgtccggtgtatctttctacaacgataacgacaaccgtagacagatattcttc
accggtaatattattggattctggttggaagtttgtttcctctcaatctatttggggttg
ttgttggctgatcaagtcactcgtcgtcgtcatgtatacattttgagtgacagagcaaga
tccaaattgtacaacacattgggattcctctttgccggatggggtgctcatttcttcccc
ttcttcttaatgaatcgtcaaaagttcttgcaccattacttgccagcccatttgttggct
gcattgttttctggtggtttggtcgattttatctcgagcaacaatattcgtgattctaac
ggtcgccctacggtgtacaacaagatcaagagcacagtcattgtgaccggatgttccatc
ggcattgtgtggttcttcttctacttcagaccaatcacctacggtgataccaccttgtct
gttgaggaggtcaaggctagacaatggttggacatcaagttgcactacgccaagtag

DBGET integrated database retrieval system