KEGG   Scheffersomyces stipitis: PICST_72675Help
Entry
PICST_72675       CDS       T01023                                 

Gene name
GUK1
Definition
(RefSeq) guanylate kinase (GUK1)
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
pic  Scheffersomyces stipitis
Pathway
pic00230  Purine metabolism
pic01100  Metabolic pathways
Module
pic_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PICST_72675 (GUK1)
Enzymes [BR:pic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     PICST_72675 (GUK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_22 AAA_18 RNA_helicase AAA_33 ABC_tran AAA_28 AAA_24 MMR_HSR1 RsgA_GTPase AAA_14 NACHT ATPase_2 T2SSE AAA NTPase_1 AAA_29 DUF2075 AAA_30 Rad17 Viral_helicase1 AAA_5 KAP_NTPase cobW Cytidylate_kin Adeno_IVa2 MobB AAA_23
Motif
Other DBs
NCBI-GeneID: 4839112
NCBI-ProteinID: XP_001385169
JGI: 72675
UniProt: A3LVL2
Position
5
AA seq 193 aa AA seqDB search
MTTTKLTRPIVISGPSGTGKSTLLKKLFAEFPDKFGFSVSNTTRNPREGEKDGVDYHFTT
VENFKKDISDEKFIEWAQFSGNYYGTSIKAVKDVADTGKICLLDIDMQGVKSVKKTDLNA
RYLFLSPPSIESLRERLVGRGTETDDSLEKRISAASAELEYAKTGAHDKIIVNDDLDKAY
QEFKEFILADSDL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccactaagttgacaagacccattgtgatttccggaccttctggaaccggtaag
tccactcttttgaagaagctctttgctgagttcccagacaagttcggcttttccgtttcc
aacaccaccagaaaccctagagaaggtgaaaaggacggagtcgactaccatttcaccact
gttgaaaacttcaagaaggatatcagcgatgaaaagttcattgaatgggcccaattttcc
ggtaactactacggtacctccatcaaggctgttaaggacgtcgctgacacaggcaagatc
tgtcttttggacatcgacatgcagggtgtcaagtctgtcaagaaaaccgacttgaatgcc
cgctatttgttcctcagtcctccttctatcgaatccttgagagaaagattggttggaaga
ggtaccgaaaccgacgactcgctcgaaaagagaatttcagctgcctcagccgaattggaa
tacgccaaaactggtgcccacgataaaatcattgtcaacgacgacttggacaaggcatat
caagaattcaaggaattcatcttggccgattctgatttgtag

DBGET integrated database retrieval system