KEGG   Scheffersomyces stipitis: PICST_72675Help
Entry
PICST_72675       CDS       T01023                                 

Gene name
GUK1
Definition
guanylate kinase (GUK1) (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
pic  Scheffersomyces stipitis
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PICST_72675 (GUK1)
Enzymes [BR:pic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     PICST_72675 (GUK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 193 aa AA seqDB search
MTTTKLTRPIVISGPSGTGKSTLLKKLFAEFPDKFGFSVSNTTRNPREGEKDGVDYHFTT
VENFKKDISDEKFIEWAQFSGNYYGTSIKAVKDVADTGKICLLDIDMQGVKSVKKTDLNA
RYLFLSPPSIESLRERLVGRGTETDDSLEKRISAASAELEYAKTGAHDKIIVNDDLDKAY
QEFKEFILADSDL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccactaagttgacaagacccattgtgatttccggaccttctggaaccggtaag
tccactcttttgaagaagctctttgctgagttcccagacaagttcggcttttccgtttcc
aacaccaccagaaaccctagagaaggtgaaaaggacggagtcgactaccatttcaccact
gttgaaaacttcaagaaggatatcagcgatgaaaagttcattgaatgggcccaattttcc
ggtaactactacggtacctccatcaaggctgttaaggacgtcgctgacacaggcaagatc
tgtcttttggacatcgacatgcagggtgtcaagtctgtcaagaaaaccgacttgaatgcc
cgctatttgttcctcagtcctccttctatcgaatccttgagagaaagattggttggaaga
ggtaccgaaaccgacgactcgctcgaaaagagaatttcagctgcctcagccgaattggaa
tacgccaaaactggtgcccacgataaaatcattgtcaacgacgacttggacaaggcatat
caagaattcaaggaattcatcttggccgattctgatttgtag

DBGET integrated database retrieval system