KEGG   Scheffersomyces stipitis: PICST_73391Help
Entry
PICST_73391       CDS       T01023                                 

Definition
hypothetical protein
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
pic  Scheffersomyces stipitis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:pic00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PICST_73391
Translation factors [BR:pic03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    PICST_73391
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 712 aa AA seqDB search
MSLTEAEYHELEKQVNLDDIDFSDLEEQYEVDVGLDNYVVVDGAPIAPEAKVPVLIKVLK
KLFNTVGKVVEGDEGIYMPLEDGKSKGYLFVQFETSEMAEAAIKQLHGKKLDQKHRLLVN
RLSDIEKYGVEGNVAAEFVEPELPPFKSHGYLKSWLQDPQGRDQIALHHSETFGVFWNKK
KSDPEPVFEPRKFFTSKYAKFSPKGTYLFSIHPQGVQSWGGADFSSIDKFMHNQVRLVDF
SPNEKYMVTLSPLPITAPDSAAERAVFPFGPESYGHKLVIWDLTTGEPARTFALPPHLEG
QKEMPWPLVKWSHDDKYCARQGPGALAVYETPSFQLLDKKLIKIDDIVDFEWAPAGVHLA
NNKSENGHHLLSYWTPESSNQTARVAVMQIPTRQILRTVNLFQVSDCKMHWQSEGKLLCV
KVDRHTKSGKTIFTNLEFFKTTEKDIPVEKLELKEIVINFAWEPKSERFVIISRLDDGNL
NSAIPKNIIDFYAPDVNGKGKSATSVYKSYKTITDKHSNTVFWSPKGRYVVVATISRSNG
EIEFFDVSFDDSNKNAPANVKLLKNDKFSGMTNISWDPSGRFVATWSSSWLHTIENGYKL
YEFTGNLLRDDSIDQFKEFIWRPRPASLLNSADRKKVRANLREYSAQFEESDAMEADAAL
RELIYARRRALEDWKAYRAKHASKAVKANEVQAEIIEEIKEEIIEEKEEIVE
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atgtccttgacagaagctgagtatcacgagcttgagaagcaagttaacttggacgacatt
gacttttccgacttggaagagcaatatgaagtcgatgtcggcttagacaattatgttgta
gtagacggtgccccaattgcaccagaggccaaggtccctgtattgatcaaggtcttaaag
aagttgttcaacactgtaggaaaggttgttgaaggcgacgaaggaatttacatgcctttg
gaagacggaaaatcgaagggttacttgtttgttcagtttgaaacttcggaaatggccgaa
gctgcaatcaagcagttgcatggcaaaaagttagatcagaagcacagattgcttgtcaac
agattgtctgatatcgagaaatacggtgtagaaggcaatgttgctgccgaatttgtagaa
ccagagttacctccattcaagagccacggctacttgaagtcatggcttcaggatcctcag
ggcagagaccaaatagccttgcaccattctgagacatttggtgttttctggaacaagaag
aagagcgaccccgaacctgtctttgagccaagaaagttcttcacctcgaaatacgccaag
ttctctccaaagggtacctacttgttctctatccatccccagggtgttcagtcttggggg
ggagctgatttctccagcattgacaaattcatgcacaaccaagtccgtttggttgacttt
tcccccaacgaaaagtatatggtgactttgtcgccacttccgatcactgcacctgattct
gctgctgaaagagctgttttcccctttggaccagagtcttatggccacaagttggtcatc
tgggacttgaccactggtgaaccagctagaacttttgccttgcctccccacttagaagga
cagaaggaaatgccatggccattggtcaaatggtcccatgacgataagtactgtgctcgt
caaggtcctggtgctttagctgtttacgaaaccccatcgttccagttgttggacaagaag
ttgatcaagattgacgacattgtcgactttgagtgggcacctgctggcgtccatcttgcc
aataacaagtccgagaacggccaccacttgttgtcgtactggactcctgaatccagtaac
caaactgctagagtcgctgtgatgcaaattccaacgagacagatcctcagaaccgtcaac
ttgttccaggttagcgactgtaagatgcactggcaaagcgaaggtaaactcttgtgtgta
aaggtagaccgtcataccaagtctggtaagaccatctttaccaacttagagttcttcaag
accactgaaaaggacatccctgtagagaaattggagttgaaggaaatcgttatcaacttc
gcctgggaaccaaagtccgagagatttgttatcatctccagattagacgatggcaacctc
aactccgccatccctaagaatatcattgacttctacgctccagatgtgaatggtaagggt
aagtctgccacatctgtatacaagtcgtacaagaccattactgacaagcactctaacact
gtcttctggtcaccaaagggtagatatgttgttgtagccaccatctccagaagtaacggt
gagatcgagttctttgatgtttcgtttgatgactctaacaagaacgctccagctaacgtc
aagttgttgaagaatgacaagttctctggtatgacgaacatcagttgggacccatctggt
agatttgtagcaacttggtcgtcttcgtggttacatactatcgaaaacggttacaagtta
tacgagttcacaggtaacttgttgagagatgactccatcgatcaattcaaggaatttatc
tggagaccaagaccagcctctttgttgaactctgccgacagaaagaaggtcagagccaac
ttgcgtgagtacagtgctcaattcgaagagtctgacgccatggaagctgatgctgctctt
agagaattgatctatgccagaagaagagccttggaagactggaaagcctacagagctaaa
cacgccagcaaggctgtcaaggctaatgaggttcaagctgaaatcattgaagagatcaag
gaggagatcattgaagagaaggaagagattgttgagtaa

DBGET integrated database retrieval system