KEGG   Scheffersomyces stipitis: PICST_73488Help
Entry
PICST_73488       CDS       T01023                                 

Definition
hypothetical protein
Orthology
K11252  
histone H2B
Organism
pic  Scheffersomyces stipitis
Brite
Exosome [BR:pic04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PICST_73488
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 131 aa AA seqDB search
MAPPKAEKKPASKAPAEKKPAAKKTASSTDAKKRTKTRKETYSSYIYKVLKQTHPDTGIS
QKAMSIMNSFVNDIFERIASEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGT
RAVTKYSSASN
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggccccaccaaaagctgaaaagaagcctgcctctaaagccccagctgaaaagaagcca
gctgctaagaagactgcctcttctaccgacgctaagaagagaaccaagaccagaaaggaa
acttactcttcgtacatctacaaggtcttgaagcaaactcacccagacaccggtatttct
caaaaggccatgtccatcatgaactcctttgttaacgatatctttgaaagaatcgcttcc
gaagcttccaagttggctgcctacaacaagaagtccaccatctctgccagagaaatccaa
actgccgttagattgatcttgccaggtgaattggctaagcacgctgtttctgaaggaact
agagctgtcaccaaatactcttctgcttccaactag

DBGET integrated database retrieval system