KEGG   Scheffersomyces stipitis: PICST_74320Help
Entry
PICST_74320       CDS       T01023                                 

Gene name
KOG1
Definition
Kontroller Of Growth
Orthology
K07204  
regulatory associated protein of mTOR
Organism
pic  Scheffersomyces stipitis
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 1399 aa AA seqDB search
MRHGFDEDYSSENFLNLLANTFYIYFDDKRQNTNGNPITAEMKQSGKYYKNYQPITDWKV
MKERQKTISAVLVLCLNLGVDPPDIMKTYPCAKLESWCDPSSFPDTKKAIENIGKNLQSQ
YETLSLRTRYKQSLDPCVEDVKRFCNTLRRNAKDERILFHYNGHGVPQPTASGEIWVFNR
GYTQYIPISLYDLQTWLGAPVIFVYDCNSAGNIVHNFKKFVQKRIDDGNEGNHDTSAPSP
TSAYLDCIQMAACKSNELLPMSPDLPADLFTCCLTCPIDISIKWFIMQSPLKKNYYSLLP
KNSVGNVIIPGKLTDRRTPLGELNWIFTAITDTIAWTSLSRPIFKRLFRQDLMVAALFRN
FLLAKRIMPHLNCNPISDPPLPDLVRFHPMWDSWDLAIDQVLAQLIKNHNLDPTTTIPVP
SAANSHFASQPTANGTGAVTAGQNLTNYQHSTFFEQQLTAFEIWLKYAGPSTKEPPEQLP
IVLQVLLSQVHRLRALILLSKFLDLGPWAVYLSLSIGIFPYVLKLLQSPAQELKPVLIFI
WARIMAIDYKSTQQELCKDKGYNYFYLILNSNPMNPIGAPGAPGSFSGAAGNTSSILIND
DHKAMSAFILTLFIKDFKNGQRLCFSIEIINNCLKFIQTSENPLLRQWCSLLLSQLWNKY
HDGKWIIYKDGYLNKLLSLINDPIPEVRTSIIVAITNFLSVYSTDQPPVPQQNSSFDLKK
DEVRQQDLKLANTILSLLGDGSSMVRKEIVFFINRFVTIYFKFFLVVAFNQLEEEIVLID
NSNYLNDFRKRSPAYGSIFSTIWKSLLILSEDPHLEVKQLAETLIDSVMVKLNESELGPL
VKEMQDYLLNKSTINISDSFKPSKPIVNRQLGHNRQVSSASMVNRKSNMLTINGSSITTR
SVSANNTNRNSMYDDSGSDTESLSSRLRNFSLNNLFKSFQMNEETDIKNFSRILNSGPVQ
TNYGNEYRPKTPLYRARDLSQVPELPAESGFFEYSCEYFQEPQMSKNEIDEPGSKEYVKR
LWRRNRNESIIQETQPQKELAVRGDWNRNVKTLNNKSQPKFIKFTQFEKILVASDEKDNV
SVWDWEENKIVKKFSNGNPFGTKITDMKFLNEDDLPLLLTGSSDGVIKIYKNFHNYEDES
ENEVNDTRIELVASWRALTDLLLTSKSSGLISEWQQSRGSLLVSGDVKIIRVWDAPRELC
LVDIPARSSSSITSLTSDQVAGNIFIAGFDDGSLRVYDRRLDSRESMVKTWRGTRSANVN
GSNSPIRTIGSGSIRNVHMQRGGFRELVSGSGDGYVNLWDIRLDEPVLTFNAAEKSMRCI
DTHEHAPIITTGSKAVNLWTTSGDLISTLRNPQETYLTNRTSSYLSTTTFHPHRMTMATN
YNQDGHINVYTCSDTVVEY
NT seq 4200 nt NT seq  +upstreamnt  +downstreamnt
atgcggcacggatttgatgaggactatagcctggagaactttctcaatttgttggccaat
accttctatatctactttgatgataagagacaaaacacaaacgggaatcccatcacagct
gagatgaagcagctgggcaagtactacaagaattaccagccgataaccgattggaaagtg
atgaaggaacgtcaaaaaactattagtgccgttttggtgctctgtttgaatctaggcgta
gatcccccagatatcatgaagacatatccgtgtgctaagctagagtcgtggtgcgaccct
tcttcgtttcctgataccaaaaaagccatagaaaacataggcaagaacctccagtcacag
tatgaaacactttcgttgagaacgcggtataaacagtcgcttgatccgtgcgtggaagac
gtcaaacggttctgtaataccctccgtagaaatgccaaagacgagcgtatccttttccac
tacaatggtcacggtgttcctcagccaacagcaagtggtgagatctgggtgttcaaccga
ggctatacacagtatattcccatctcactttacgatttgcagacatggctaggagcacct
gtcatttttgtttatgattgcaacagtgctggcaacatcgtacacaacttcaagaagttt
gttcagaagagaatagacgatggtaatgaaggaaatcacgataccagtgccccatctcca
acttcggcttacttggactgtatccagatggctgcctgcaagagtaacgagcttcttccc
atgagtccggatctcccagcagacttgttcacctgttgtctcacctgtcctatagacatc
agcattaagtggttcatcatgcagagcccactcaagaagaactactactcgttattgccc
aagaactctgtaggaaacgtaattatccctggtaaactcacggatcgaagaacaccccta
ggtgagttaaactggatcttcaccgctatcacagatacaatagcctggacttcgctttca
agacccatcttcaaacgtcttttcagacaggatttgatggtggcagcactctttagaaac
ttcttgcttgcaaaacgtatcatgcctcacttgaactgtaaccctattagtgatccaccg
ttgcctgacttggtgcggtttcatccaatgtgggactcatgggacttggctatagaccag
gtgttggcacaattgatcaagaaccacaatcttgatcctactacaactattcccgtgcct
tcagctgctaactctcactttgcatcacaacctactgccaatggcacaggtgctgttaca
gcaggccaaaacttgaccaactaccagcattctacatttttcgagcaacagctcacagcc
tttgaaatctggctcaaatacgcaggtccctctacaaaagaaccccctgaacagttgcca
atagttctacaggttcttttgtctcaggttcatagacttcgtgctcttatcctactttct
aagttcttggacttgggtccttgggctgtgtatttgtcactttctattggtatctttcca
tatgtattgaaattgttgcagagcccagctcaggaactaaagccagtcttgattttcatt
tgggccagaatcatggctatagactacaaaagcacacaacaagagttgtgcaaggataag
gggtataactacttctatctcatcttgaattccaaccctatgaatcctattggagctcct
ggagctcctggaagctttagcggtgctgcaggaaacaccagtagtattctcattaatgac
gatcacaaggctatgagtgccttcattttgacgttgtttatcaaggacttcaagaacggg
cagaggttgtgtttttctatcgaaatcatcaacaactgcttaaaattcattcagacaagt
gaaaatccgctcttgcgacagtggtgtagtttgctattgtcgcaactctggaataagtac
catgatgggaaatggatcatatacaaagatggctacttgaacaagcttctttcgttgatc
aatgatcctattccggaagtaagaacttctatcattgtagccatcactaatttcctcagt
gtgtattcgacggatcaaccacctgttccacagcagaattcttcatttgacttgaagaag
gatgaagtaagacaacaggatctcaagttagccaatacaatcttaagtttgcttggggat
ggctcgtcgatggtgagaaaggaaattgtatttttcatcaaccgattcgtcaccatatac
ttcaagttcttcttggtggttgctttcaatcagttagaagaagaaatcgtcttgattgat
aactccaactacttgaacgacttcagaaagagatcgcccgcttatggttctattttcagt
acgatctggaaatccctcttgattctttctgaagatccacatcttgaagttaagcaattg
gcagaaactttgatagattctgtcatggtcaagttgaacgaaagtgagttgggaccatta
gtcaaagaaatgcaagactatttattaaataagtctactattaatatcagcgacagcttc
aagccatcgaaacctatcgttaatcgtcaattgggccataatagacaggtttccagcgca
tccatggtcaacagaaaatcaaacatgttgaccataaacggctcttctatcactaccaga
tcagtatctgctaataacacgaaccgcaacctgatgtatgatgacagtggctcagacaca
gaatcattatcttccagactcaggaatttctctttgaacaatcttttcaagtcattccag
atgaatgaggaaacagacatcaagaatttctcaagaatactcaactcgggaccagtacaa
accaactatggcaacgagtaccgtcccaaaactccattgtatagagcaagagacttatct
caggttccagagttgcctgccgagtctggattctttgagtacagttgtgaatacttccaa
gagccacagatgtctaagaatgaaattgacgagcccggttcaaaagaatacgtaaaacgg
ttatggagacgtaacagaaacgagtccatcatccaagaaactcaaccgcaaaaagaattg
gctgttaggggtgattggaacagaaacgttaagactttgaataacaaatcgcagcctaag
ttcatcaaattcactcagttcgaaaagattttagttgctagtgacgaaaaggataatgtg
tctgtttgggattgggaagagaataagatcgtcaagaagttttccaacggcaatcctttt
ggtactaagattacagatatgaaatttttgaatgaagacgatcttccattgttgctcact
ggttcttctgatggtgttattaaaatctacaagaacttccacaactatgaagatgaaagc
gaaaacgaagtcaacgatacaagaattgagttggtagcttcatggagagccttgacggat
cttttgttgacttccaagagttcagggttgatttcagaatggcagcaatcccgaggttcg
ttgcttgtaagtggtgatgtcaagattatacgagtctgggatgctcccagagagttgtgt
ttggtggatattccggcaagatcgtcttcttccataacttctttgacttcggaccaagtt
gcaggaaatatatttatagctggttttgacgatggtagtttgagagtgtatgacagaaga
ttagactcgcgtgaatccatggtcaagacttggagaggtacgagaagtgccaatgtcaac
ggtagcaactctcctatccgaaccatcggctcgggatccatcagaaatgtgcacatgcaa
agaggtggattcagagagctcgtcagtggctcaggcgacggatatgtcaatctctgggat
atccgtttggatgagccggtgttgacattcaacgcagcagagaaatcaatgcgttgcata
gatacgcacgaacacgcccccatcattactactggctctaaagctgtcaatctttggact
acttcaggagatcttatctcaacattgagaaatcctcaggaaacatacttgaccaatcgt
acttcaagctacttgtcaacaacgacattccatccgcacagaatgacaatggctactaac
tacaaccaagacggacatatcaacgtatacacctgtagtgatactgttgtggagtattga

DBGET integrated database retrieval system