KEGG   Scheffersomyces stipitis: PICST_75489Help
Entry
PICST_75489       CDS       T01023                                 

Gene name
RBK1
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pic  Scheffersomyces stipitis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PICST_75489 (RBK1)
Enzymes [BR:pic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     PICST_75489 (RBK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 333 aa AA seqDB search
MTIITVIGSLNYDLVTFTKKVPEAGETYQADAFENHLGGKGLNEALASSRLSADDSTQVR
MIGNVGSDTFGKELVHELEVTGVNTTYVKTIEGKASGVAVILVEEDSGENRILITAGANG
ELKPTEDDYSLYFPREEADAHYLILQNEYPDTFNTITWIKQNRPNINIAYNPSPFKPEFI
TSEVLSRIDLFIVNEGEAMDVAKHLLQDEEYSKFEASITQNSIEGFKSLALKLQTLVNQN
NIKTIIITMGSRGATYVSKETEVPQYEPSRKVQHVVDTTGAGDTFFGGVVSSLAGGKKIE
DAVKFATTASSLAIQKKGAAESIPHYDEVLKNL
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgactatcatcactgtcattggatccctaaactacgacttggttactttcaccaaaaaa
gtgccagaggctggcgaaacgtaccaggccgatgcctttgaaaaccatcttggtggaaaa
ggtctcaacgaagctctagcctcgtccagattaagtgcagacgactctacgcaagtcaga
atgattggaaatgttggatctgacacttttggaaaggaattggtccatgagctcgaagtc
acgggtgtaaacactacctatgtgaagacaatagaaggcaaggcatctggagttgcagtg
attcttgtggaagaggacagtggagagaaccgtatcttgattactgccggagccaatggc
gaattaaagccaacggaagatgactattctctatactttcctcgggaagaagctgatgct
cattacttgatccttcagaacgaatatccagacaccttcaacaccatcacttggatcaaa
cagaatcgtcctaacatcaacatcgcatacaacccttcgcccttcaagccggaattcatc
acctcggaggttttgtcgagaatcgatttattcattgtgaatgaaggtgaagccatggat
gtagccaaacatctcttgcaagatgaggaatattctaagttcgaagcaagtatcacccaa
aacagcattgaagggttcaagctgttagctcttaagttgcaaaccttagtcaatcagaac
aatatcaaaaccatcatcataactatgggtagtcgcggagctacatatgtgtccaaggag
acagaggttccacaatatgagccttcaagaaaggtccagcacgtagtggacacaactggg
gctggagacactttcttcggcggagtggtcctgagtcttgctggaggaaagaagatcgag
gacgcagtcaagtttgctactactgctagcagtttggctatacagaagaaaggagcagct
gagagtattcctcactacgatgaagttttgaagaacctttag

DBGET integrated database retrieval system