KEGG   Scheffersomyces stipitis: PICST_77156Help
Entry
PICST_77156       CDS       T01023                                 

Gene name
BHA1
Definition
glycosyl hyrolase, family 3-like protein (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pic  Scheffersomyces stipitis
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PICST_77156 (BHA1)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    PICST_77156 (BHA1)
Enzymes [BR:pic01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     PICST_77156 (BHA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 1010 aa AA seqDB search
MSPSNLPPFHVGQLLCGGFQGTTVTPQAYHLIVDHHVSSMILSRKNALSAQQMSKLIRDL
QYIAFSQGHYQYPIMFAIDEEGGMMNSLFDPDFLTQCPGAMALAATGDTELVYELSKAIA
IELKNIGFSIILGPVLDVVTKLSHQLVGVRSFGTTIEDVSKYSQACAKGLQEGGLFTVGK
HFPGIGNATVDSLLELPMIVDSLDQIKHFNSLPFAKLIEQNLLDGISAAGCGVPTISPDE
THACLSPVVINQLLRQDLKFKGFVISECLEMDALYHSIGLGQGVILAISAGCDLVMVCHD
MALQNEAVECLEKAIANGNLDDEIILASLNRIERLQKRLPKWSQLFPRGEISAKEDEIKL
FKYEHPELWEKHQKLASLAYQKSITLVRDYNHTLPISKFLSSSEDDKKIDHILILSPLLN
PIYPSTKSHSKDDQTQQLYTGEEVFQKFGDLLANNSLSKTKSYNVLHTTYTANGLTQLHE
SLIEKSKVVIVLTSEASRNMYQIGIVKYVSILCGANPASFNNSGATYFQLAKPLIIVATS
SPYDFFYNKTMGSAYLCCYDYTNSALEKLAGVLMGDFEPEGCIPGEKKFIGKSKKRKSTG
SVEGVRMEKPLSMKKIKSSTPKRRWLVDEFDLNRDWTGLQKLWKNNTVESDMATGTNHNK
IDYSVPDFYKRLYGLLATTAKSQKHFVVRNSSLNILYGVVLTWVDENLPLDGDLTSEEQI
RGSILYILVDKSRRLQSIGKNLHARAIRYLLKERKCSTITLGSSFPLFVFPENSNISNNR
SNSKISTFMQSIGWDVNVTKSAKKYVMQLGDLDNWSVPKKIFRELMIVGVRFDICSDPEK
LMKLIARSTKENENSDDNKGIKGLYLEAVKHLGNTSPYGTKIIIALEPTNQNVIGSIVLF
TNKSQLSKFFPFIDELKADDEGVIGGIIGPIIDPSYSNLTEIFKYGLICSGITFLKSNLN
DGDTTMNQCMMLDVNDDKSLTGIKEIGFSEWKYYYDYYDKKNNAEKAFLD
NT seq 3033 nt NT seq  +upstreamnt  +downstreamnt
atgagcccgctgaatcttccgccgttccatgtgggacagcttctctgcggaggctttcag
ggaaccacggtcacaccgcaagcgtaccatttgatcgtcgaccatcacgtctcgctgatg
attttgtcccgcaagaatgccttgctggcacaacagatgctgaagttgatcagagatttg
cagtatatcgctttttcgcagggccattaccaatatccaatcatgtttgctatagacgaa
gaaggaggcatgatgaactcgctttttgatccagatttcttgacccaatgcccaggagcc
atggctcttgctgctacaggagatacagaacttgtgtacgagcttctgaaggcaattgct
atcgagttgaagaacattggtttcctgattatattgggtcccgtgttagacgttgtcacc
aagctctcacatcagttggtaggagtccgcagctttggaactaccatcgaagacgtgtct
aaatacagtcaggcctgtgctaaaggattgcaagagggtggtttgttcactgtagggaag
catttccctggaatcggtaacgctaccgtagatagtcttctcgaattgcccatgattgta
gattcattggaccagattaagcacttcaacagcttgccatttgccaaactcatcgagcag
aatcttctcgacggaatcagtgctgcaggatgtggagttccgacaatctctccagacgaa
acccacgcctgcttgtcgcccgtagtcataaaccagttgcttcgtcaagatttaaagttc
aaaggttttgtaatctctgagtgtttggaaatggatgctttgtaccatctgatcggtttg
ggccaaggtgtcattcttgccatctctgctggttgtgatctagtcatggtgtgtcatgac
atggctcttcagaatgaagctgtggaatgccttgagaaagccatagccaatggcaatctc
gatgatgaaatcatccttgcaagcttaaatagaatagagcgcttgcagaagcgattgcct
aaatggtcacaacttttccctagaggtgaaatttcagccaaggaagatgagatcaagttg
ttcaaatacgagcatcctgagttgtgggagaaacatcagaaattggcctcgctagcctat
cagaaatctatcactcttgttagagactataatcatactctacccatctcaaagttcttg
tcttccagtgaggacgataagaaaattgatcacattctcatattgtcacctttgcttaat
cctatttatccatccactaaactgcacagcaaagacgaccaaactcaacagctctacacc
ggagaagaagtatttcagaagtttggcgatttgcttgctaataattcgttgagtaaaacc
aaatcctacaacgtgttacacactacatacacagctaacggattgactcagcttcacgaa
ctgctcattgaaaaatcgaaagtcgtcattgtcttaacttccgaagcttccagaaatatg
taccaaatcggaatagtcaaatatgtatcgattttgtgcggagcgaaccctgcttctttc
aacaactcgggtgctacgtactttcaattggcaaagcctctaatcatagtagctactctg
tctccatacgactttttctataacaagacgatgggcagtgcctatttatgctgctatgat
tacacgaacagtgctcttgaaaagcttgctggggttctcatgggtgactttgaaccagaa
ggctgtattccaggcgagaagaaattcatagggaagtctaagaagaggaaatcaacagga
tcagtggaaggagtgagaatggaaaaaccacttctgatgaaaaagatcaagagctctaca
cccaagagaagatggttagtcgacgagtttgacttgaaccgtgactggactgggctccaa
aaactctggaaaaacaatacagtagaatcagatatggcgactggaacgaatcacaacaaa
attgactattcagtgcccgacttctacaagagactctacggactattggcgactactgcc
aagtctcagaaacattttgtggtcagaaactcttctctcaatatattatacggtgtagtt
ttaacctgggtcgatgaaaacttacctcttgatggtgacttgacctcagaagaacagatt
agaggctcgatactctatatcttggtggacaagtccagaagattgcagagtattgggaaa
aacctccatgccagagctattcggtatcttttgaaagagaggaaatgctctaccatcaca
cttggatcatcttttccgttgtttgtgtttcccgagaactctaacatttctaacaatcgt
agcaactccaagatatctacgtttatgcagagtattggctgggatgtgaacgtcacaaag
tcagcgaagaagtatgtaatgcaactaggagacttggacaactggctggtcccaaagaaa
atattcagagagttgatgatcgttggtgtcaggttcgatatatgtagcgatcctgagaag
ctcatgaagctcattgctcggtcaacaaaggaaaatgaaaattccgacgataataaaggc
atcaaggggctttatttggaggctgtcaaacatttgggaaatacctctccctatggtacc
aagatcattattgcattggagcctacgaaccaaaacgtaattgggagcattgttctattc
acaaacaagtcgcagttgtctaaattcttcccattcattgacgaattaaaggcagatgac
gaaggagtaattggaggaattattggaccaattatagatccactgtattcaaacttgacg
gaaatcttcaaatatggattgatctgcagtggaatcacattccttaaatccaatttgaat
gacggagacaccacaatgaaccaatgcatgatgctagatgttaatgatgacaaatcgctc
acaggtataaaggagattggattctccgagtggaaatattattacgattactatgacaag
aaaaacaacgccgaaaaggcatttcttgattga

  All links  
No link information was found.   
DBGET integrated database retrieval system