KEGG   Scheffersomyces stipitis: PICST_77577Help
Entry
PICST_77577       CDS       T01023                                 

Definition
hypothetical protein
Orthology
K14298  
mRNA export factor
Organism
pic  Scheffersomyces stipitis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:pic00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PICST_77577
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 365 aa AA seqDB search
MSFLNSASPASTTTGPGSVINDITVNNPPDDSITDLSFSPQQDLLAAASWDRKVRIYEID
SNSGNNQGRALFEHEAPVFSVAWTYDGTKVVSGGADKQVKLFDLQTQQSQQIGAHDAPVR
AVRYVECGPSNTPAVVSGSWDKTLKYWDMRSPQPITTIQLPDRVYTMDSSQKLLVVGCAE
RQIVVIDLNQPQQIFKNSLSPLKWQTRAISCYPQGNGFAVGSIEGRCGIQYINEQDQTKQ
GFAFKCHRKMGSNTTTSTIRSVSSTSQAYPVNAISFHPVYGTFSTAGSDGTFSFWDKDAR
QRLKSFPELNGSITATAFNKNGSIFAYALGYDWSQGYMGNRPDYPVQIKLHGTKDDEVKQ
KKKRI
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtttctcaacagtgcctccccggcctccacgacaactggaccagggctggtgatc
aacgatatcactgtaaacaatcctccagatgactcgataacagacttgtcattttcaccg
caacaagacttacttgctgcggcttcttgggacaggaaggttcggatctacgagattgac
tccaactccggaaacaaccagggccgagcccttttcgaacacgaagcacctgtcttctct
gttgcatggacctacgatggtaccaaagtagtgagtggcggtgctgacaagcaagtgaag
ctttttgatcttcaaactcagcaatcgcaacaaattggtgctcacgatgctcccgtaaga
gcagttcgttatgtagaatgtggtccttccaatacacctgcggtagtgtcgggctcttgg
gacaagactctcaagtactgggacatgagatcgccacagccaattacaaccatacagctt
ccagaccgtgtctacactatggattccagtcagaagttgttggttgtaggctgtgctgaa
cgtcaaattgtcgttattgacttgaaccagcctcagcagatctttaaaaactcgctctct
cctttaaaatggcaaaccagagccatcagctgctatccacaaggaaacggttttgccgtc
ggctccattgaaggaagatgcggcattcagtacatcaatgaacaggaccagacaaaacag
gggtttgcattcaaatgtcaccgcaaaatgggcagcaacaccaccacttcaaccataaga
tcagtatcctcgacgtcacaagcgtatcctgtcaatgccatatcgttccatcccgtctat
ggcacattcagcacagctggttccgacggaaccttcagtttctgggataaggacgctcgc
cagaggctaaagtcattcccagagctcaacggctccatcacggccactgcgttcaacaaa
aacggaagcatctttgcatacgccctaggctacgattggtcccagggctatatgggcaac
aggcccgactatccggtgcagatcaagttgcatggtacgaaggatgacgaggtgaagcag
aagaagaaaagaatttag

  All links  
No link information was found.   
DBGET integrated database retrieval system