KEGG   Scheffersomyces stipitis: PICST_77786Help
Entry
PICST_77786       CDS       T01023                                 

Definition
hypothetical protein
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
pic  Scheffersomyces stipitis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 675 aa AA seqDB search
MALDTLDFAVILVLTVAILAYIVKTNFFSEPKSTGFLSADALAGNNLLDVIKKNNKNAVI
FYGSQTGTAEDYASKLSKELSARFGLKTMTVDFSDYDLTNFDSISEDTLCFFLMATYGEG
EPTDNANEFCEWLENDADTLSTLKFTVFGLGNSTYELYNAVGKKLDQQFEEKGAERFADY
GEGDDGKGTLDEDFLTWKDNLFESLKNNLNLEEHELTYEPGLRLEESDFLTLADDNVSHG
EPDKTYITGSGDLSKGPFDHSHPYLSPIKYTKELFNSKDRSCVHLEFDLSGSNLRYSTGD
HVAIWPSNSNENILTFAKAFGLEDKLDTVFELVALDLTISIPFPTPISYGAVLRHHLEIT
GPVSRQFLLSIAGFAPDASSKKEVARIGNDKKAFAEEITHKSLNIADALLVISDGKPWSS
VPFEFIIESISHLQPRYYSISSSSLTEKTTINVTAVVEAEKVGSQLVTGVVTNLLKNIEI
EQNKTGEKPVVTYDLSGPRGKFSKFKLPIHVRKSTFKLPTNPSTPVILVGPGTGVAPLRG
FVRERVNQKQNGTSVGETVLFYGCRRSDEDFLYKDEWPQYAKTLGSSFEIHTAFSRETEK
KVYVQHKILEQSSKINKLLESGAFIYVCGDASRMARDVQASFAKILSQERGISEEKAGDL
LRSYKTQNRYQEDVW
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atggctttagatactttggacttcgccgtcatcttggtgctcactgtggccatactagcg
tacatagtcaaaacaaacttcttctccgagccaaagagcactggtttcctttcggctgac
gctcttgctggcaacaacttgttggacgtaatcaagaaaaacaacaagaatgcagtcatt
ttctatgggtctcagactggtactgctgaagactatgcctccaagttgtcgaaggaattg
tctgccagattcggcttgaagaccatgacagtggacttctccgattatgacctcaccaac
ttcgacagcattagcgaagatactctctgtttcttcctcatggctacctacggtgaaggt
gaaccaaccgataatgctaatgaattctgtgaatggcttgaaaacgacgctgacactttg
tccaccttgaagttcactgtctttggcttgggtaactcgacttacgaactctacaatgct
gttggtaagaagctcgaccagcagttcgaagaaaagggtgctgagagatttgctgactac
ggcgaaggtgacgatggtaaaggcactttggacgaagactttttgacctggaaggataac
ttgtttgaatcgttgaaaaacaacttgaacttggaagagcacgaattgacttacgagccg
ggcttgagattggaagaaagtgacttcttgaccctcgccgatgacaatgtttcccacggc
gaacctgacaagacctacattaccggttcaggtgatttgtccaaaggaccttttgaccac
tctcacccttacttatctcctatcaaatacaccaaggaattgttcaactcgaaggataga
tcttgtgtccatttagagtttgacctttctggttccaacttgaggtactctactggtgat
catgtggctatctggccatccaattccaacgagaacattcttacttttgctaaagccttt
ggtttggaagacaaacttgacactgtgttcgaattggtagctttggatttgactatttcc
atccctttccccactcctatctcgtacggtgctgttctcagacatcatttggaaatcact
ggtcctgtttcaagacagtttttgctttcaattgctggttttgctcctgacgcttcttct
aagaaggaagttgctagaattggtaatgataagaaggcctttgcagaagaaattacccac
aagagcttaaacattgctgatgccttgttggttatttctgacggaaagccatggtcgtct
gttccttttgagttcatcattgaatcgatttcccacttgcagcctcgttactactccatc
tcgtcttcttctttgacggaaaagactacaattaatgttactgctgtcgttgaagctgaa
aaggtcggatctcaattggtcactggtgtagtcacaaatttgttgaagaatattgaaatt
gaacaaaataagactggagaaaagccagtggttacgtacgacttgagcggccccagaggc
aagttctccaagttcaagcttccaattcacgtcagaaagtccaccttcaagttgcctact
aatccttccactcccgtcattttggttggtcctggtactggtgtggcccctttgagaggt
tttgtaagagaaagagttaaccaaaagcaaaacggtacgtctgtaggtgaaaccgtgttg
ttctatggctgcagaagactggacgaagatttcttgtacaaggatgaatggccccaatac
gcaaagactttgggatccagctttgaaatccacactgcattctcaagagaaactgaaaag
aaggtctacgtgcaacataagatcttggaacagtcttcgaagatcaacaaattgttggaa
agcggagcctttatctacgtctgtggtgatgcttcccgtatggccagagacgttcaagct
agtttcgctaagatcttgtcccaagaaagaggtatctccgaagaaaaggcaggtgatttg
ctcaggtcatacaagacccaaaacagatatcaagaagatgtctggtaa

DBGET integrated database retrieval system