KEGG   Scheffersomyces stipitis: PICST_78364Help
Entry
PICST_78364       CDS       T01023                                 

Gene name
CAR1
Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
pic  Scheffersomyces stipitis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PICST_78364 (CAR1)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PICST_78364 (CAR1)
Enzymes [BR:pic01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     PICST_78364 (CAR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 317 aa AA seqDB search
MTEIQYKFHPNKKATIITAPFSGGQPKGGVELGPEYILNAGFEKQAQALGWETAVVHPLA
NTDYESKKTDDKDSYGIKNTSIVSQCCEKIHTAVKSALDSDSLPITVGGDHSIGMATVSA
ALEHNPDACVLWIDAHADINTPKTTDSGNLHGCPISFVMGIDRESFPPEFSWVPENLKPN
KIAYIGLRDVDEGEKAILKKYNIPAFSMYHVDKYGIGKVVDMALDAVNPDRKNPIHLSYD
VDAIDPSFVPATGTRVEGGLSLREGLFIAEDVAQTGLLASIDIVETNPLLAETEEHVLDT
VSAACAIGRCALGQTLL
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaatccaatacaagttccaccctaacaagaaggccaccatcatcacggctcca
ttttccgggggccaacccaagggaggagtcgagttaggcccagaatacatcttgaacgcc
ggatttgagaaacaagcccaagccctcggatgggagactgctgtggtccatcccttggca
aacaccgactacgaatcgaagaagaccgacgacaaggactcgtatggaatcaagaacacc
agcattgtgtcgcaatgctgcgaaaagattcacactgctgtgaaatccgctttggattcc
gacagcttgcctatcacagtcggaggagaccattccatcggtatggccactgtctcggct
gctcttgaacacaaccctgacgcatgtgtgctttggattgacgcccatgctgacatcaac
actccaaagacaactgattccggaaacttgcacggctgtccaatctcatttgtaatgggt
atcgacagagagtcgtttcctcccgaattcagctgggttcctgaaaacttgaagcctaac
aaaattgcttacattggattaagagacgtcgacgaaggagaaaaggctatcttgaagaaa
tacaacatcccagcattctccatgtaccacgtcgacaagtacggaattggaaaagtagta
gacatggctcttgatgccgtcaaccctgacagaaagaacccaattcacttgtcgtacgac
gtagatgccatcgacccttcgtttgttcctgccacaggaaccagagtcgaaggtgggttg
tcgttgagagaaggtttgttcattgctgaagatgtagcccaaaccggtttgttggcttct
atcgatatcgtggagactaacccgttattggctgagactgaagaacacgtcttggacaca
gtgagtgcagcttgtgccatcggtagatgtgccttgggtcaaactcttttgtag

DBGET integrated database retrieval system