KEGG   Scheffersomyces stipitis: PICST_78456Help
Entry
PICST_78456       CDS       T01023                                 

Gene name
GPX2
Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pic  Scheffersomyces stipitis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PICST_78456 (GPX2)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PICST_78456 (GPX2)
Enzymes [BR:pic01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PICST_78456 (GPX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 160 aa AA seqDB search
MSKFYELTPKDAKGNDFPFVELKGKVVVIVNVASKCGFTPQYKELEELNKKYEGKNVQII
GFPCNQFGHQEPGTADEIASFCQLNYGVTFPVLAKVEVNGDNADPVYKFLKGEKSGVLGL
TRIKWNFEKFLIDKNGKVVERFSSLASPSSLGPKIDQLLK
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaattctacgagttgactcctaaggacgccaagggcaacgacttccccttcgtg
gaattgaagggcaaggttgtcgttattgtcaacgtcgcttccaagtgtggctttactcct
cagtacaaggagttggaagaattgaacaagaaatacgaaggcaagaacgttcaaatcatc
ggtttcccttgcaaccaattcggccaccaggaaccaggcactgccgacgagatcgccagc
ttctgtcaattgaactacggagtcaccttcccagtgttggccaaggtcgaagtcaacggc
gacaacgccgacccagtgtacaagttcttgaagggcgagaagtccggagttttgggcttg
accagaatcaagtggaacttcgagaagttcttgatcgacaaaaacggtaaggtcgttgaa
agattctcctctttggctagtccatccagtcttggtccaaagatcgaccagttgttgaag
taa

DBGET integrated database retrieval system