KEGG   Scheffersomyces stipitis: PICST_78490Help
Entry
PICST_78490       CDS       T01023                                 

Gene name
CYC1
Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
pic  Scheffersomyces stipitis
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    PICST_78490 (CYC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 110 aa AA seqDB search
MPAPFEKGSEKKGATLFKTRCLQCHTVEEGGPHKVGPNLHGIMGRKSGQAVGYSYTDANK
KKGVEWSEQTMSDYLENPKKYIPGTKMAFGGLKKPKDRNDLVTYLASATK
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgccagctccattcgaaaagggttccgaaaagaagggtgccaccttgttcaagaccaga
tgtttgcaatgtcacaccgttgaagaaggtggtcctcacaaggttggtcctaacttgcac
ggtatcatgggcagaaagtccggtcaagccgttggttactcttacactgacgccaacaag
aagaagggtgtcgaatggtccgaacagaccatgtctgactacttggaaaacccaaagaag
tacatcccaggtaccaagatggctttcggtggtttgaagaagcctaaggacagaaacgac
ttggtcacctacttggcttccgccaccaagtaa

DBGET integrated database retrieval system