KEGG   Scheffersomyces stipitis: PICST_79135Help
Entry
PICST_79135       CDS       T01023                                 

Gene name
ACS2
Definition
acetate--CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pic  Scheffersomyces stipitis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pic01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pic00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pic00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:pic00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:pic00680]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 679 aa AA seqDB search
MTVTPQHQVVHEANGVTPRPTPKEFFDKQPRPGHITSIEQYQELYQKSIADPEGFFGPMA
KELLSWDRDFDKVKSGSLKDGDVAWFIGGQLNASYNCVDRWAYATPDKTAIIYEADEEKD
SYKLTYAELLREVSKVAGVLKSWGIKKGDTVAIYLPMTPQAVIAMLAVARLGAIHSVIFA
GFSSGSIRDRVNDASCKALITCDEGRRGGKTVNIKKLCDEALKSCPTVEKVLVFKRTGNE
NIELEEGRDFWWDEETAKFSGYLPPVPVNSEDPLFLLYTSGSTGTPKGVVHTTGGYLLGA
AMTTKYIFDVHPEDILFTAGDVGWITGHTYALYGPLALGIPTIVFEGTPAYPDFGRFWQI
VEKHKATHFYVAPTALRLLRKSGEQEIPKYDLSSLRTLGSVGEPISPDIWEWYNEHVGQG
RCHISDTYWQTESGSHFIAPIAGVTPNKPGSASLPFFGIETALIDPVSGHELEGNDIEGV
LAIKSTWPSMARSVWNNHTKYMDTYLNPYPGYYFTGDGAARDHDGYYWIRGRVDDVVNVS
GHRLSTAEIEAALIEHNGVSEAAVVGITDDLTGQAVVAYVALKNEYVDKIAGKETSDEAF
ALRKELIMTVRKEIGPFAAPKSVIIVADLPKTRSGKIMRRILRKISANEADQLGDITTLS
NPQSVVGIIDSFAAQFAKK
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atgactgttaccccacagcaccaagtcgtccacgaggccaacggtgtcaccccaagaccc
actcctaaggagttttttgacaaacagccccgtcctggccatatcacctccatcgaacag
taccaggaattataccagaagtccatcgccgaccctgaaggattctttggtcctatggcc
aaggagttgttgtcgtgggacagagacttcgacaaggtcaagtccggttctttgaaggac
ggtgacgttgcctggttcattggcggccagttgaacgcttcctacaactgtgtagacaga
tgggcctatgcgactccagacaagactgccatcatctacgaagctgacgaagaaaaggac
tcgtacaagttgacctacgccgagttgttgagagaagtctccaaggtagctggtgtgttg
aagagctggggcatcaaaaagggtgatactgttgctatctacttgccaatgactcctcaa
gctgttattgctatgctcgctgtagccagattaggtgccatccactcggttatctttgca
ggtttctcttctggttccatcagagacagagtcaacgatgcttcttgtaaggctcttatt
acctgtgacgaaggtagaagaggtggtaagaccgttaacatcaagaaattgtgcgacgaa
gccttgaagagctgtcctactgtagaaaaggtgcttgttttcaagagaaccggaaacgaa
aatattgaattggaagagggtagagatttctggtgggatgaagaaaccgccaagttctcg
ggttacttgccacctgttccagtcaattctgaagacccattgttcttgttgtatacatct
ggttccactggtactcctaagggtgttgtccacaccactgggggctacctcttaggtgct
gccatgaccaccaagtacattttcgacgtccacccagaagacatcttgttcactgccggt
gatgtcggttggattactggtcacacctatgctttgtacggacctttggctctcggtatc
ccaacaatcgtttttgaaggtactccagcctacccagactttggtagattctggcaaatt
gtcgaaaagcacaaggctacccacttctacgtagctcctactgccctcagattgttgaga
aagagtggcgagcaagagattccaaagtacgacttgtcttctttgagaacattgggctct
gttggtgaacctatctcccctgatatctgggaatggtacaacgagcacgttggacaaggc
agatgccacatctccgacacctactggcaaactgagtctggttctcacttcattgctcca
attgccggtgtcactccaaacaaacctggttcagcctctttgccattctttggtatcgag
accgctcttattgatccagtttccggccacgaactcgaaggtaacgacatcgaaggtgtt
cttgccatcaagagcacctggccatctatggctagatctgtctggaacaaccacaccaag
tacatggacacatacttgaacccatacccaggctactactttaccggcgacggtgctgcc
agagatcacgacggctactactggattagaggtagagtcgatgatgtcgtcaatgtgtct
ggtcacagattgtctactgctgaaatagaagctgccctcatcgaacacaacggtgtttct
gaagctgctgtggttggtattaccgacgacttaactggtcaagccgtagttgcctacgtt
gctctcaagaacgaatacgtcgacaagatcgccggcaaggaaaccagcgacgaagccttt
gccttgagaaaggaattgatcatgaccgtcagaaaggaaatcggacctttcgcagctcca
aagagcgtcatcattgtcgccgacttgccaaagaccagatctggtaagatcatgagaaga
atcttgagaaagatctctgccaacgaagcagaccaattgggtgacatcaccactttgtcc
aaccctcagtctgtcgttggtataatcgactcctttgctgctcaatttgctaagaaataa

DBGET integrated database retrieval system