KEGG   Scheffersomyces stipitis: PICST_81035Help
Entry
PICST_81035       CDS       T01023                                 

Gene name
RPD3
Definition
histone deacetylase transcription modifier (EC:3.5.1.48)
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
pic  Scheffersomyces stipitis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 500 aa AA seqDB search
MYVQLPFDELKVDPTQKKRIAYFYDADIGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKKM
EIYRAKPATKQEMCQFHTDEYIDFLSRVGPDNLDMFAKEQIKFNVGDDCPVFDGLFEYCG
ISGGGSMEGAARLNRGKCDIAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHPRVL
YIDIDVHHGDGVEEAFYTTDRVMTASFHKYGEFFPGTGELRDIGVGKGKYYSVNVPLRDG
IDDATYKSVFEPLISKIIEWYQPSAIVLQCGGDSLSGDRLGCFNLSMAGHANCINFVKSF
NIPMMVVGGGGYTMRNVARTWAFESGLLNNVILPSELPYNEYYEYYGPDYKLDVRPSNMY
NTNSPEFLNKILTSIITNLENTKHAPSVQMNEVPRDAEDLGDVDEDTKEAIDTKGGSQQA
RDEQIQPENEFYDEDDKDEGEKMISVPDASIEVKEKPIERAPAEEAKDVEDAKDAKDVPS
ASVLTKEELDEIEELNKGVN
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgtacgtacagcttccatttgatgagctcaaggtagatccgacacagaagaagcggatt
gcttacttctacgatgccgatatcggcaactacgcctacggagccggccatcccatgaaa
ccccatagaataagaatggcccactcgttgatcatgaactatggcttatataagaagatg
gaaatctaccgagccaagccagccacaaagcaggagatgtgtcagttccatactgatgag
tatatcgacttcttgagtcgtgtgggacctgacaacttggacatgtttgctaaagaacag
atcaagtttaacgttggtgatgactgtcctgtttttgatgggttgtttgaatactgtggt
atctcgggaggtggatccatggaaggtgctgctcggttgaaccgaggtaagtgtgatatt
gctatcaactacgctgggggattgcaccacgcgaagaagtccgaggcttcaggcttctgt
tacttgaacgatatcgttttgggtattatcgagttgttgcgctaccatcctagagtattg
tacatcgatattgatgtccaccacggtgatggagtcgaggaagcattctatactactgac
agagtgatgacagcttcgttccacaagtacggtgagtttttccccggaactggtgaactt
agagatattggagtaggcaagggtaagtactatagtgtcaatgttccgttgagagatggg
attgatgatgcaacgtataagtctgtgttcgagcccttgatcagcaagatcatcgagtgg
taccagccctcggccattgtgttgcagtgtggtggagattcattgagtggggacagattg
ggctgtttcaacttgtcgatggctggccatgccaactgtatcaactttgtcaagtcgttc
aacattcccatgatggttgtaggaggtggaggttatactatgagaaatgtagccagaact
tgggctttcgagtcgggtttgttgaacaacgtgatattgccctcggaattgccttataac
gaatactacgaatactatggtcctgactacaagcttgacgtcagaccttcgaacatgtac
aacaccaattcgcccgagtttttgaacaagatcttgaccagcatcatcaccaacttggag
aataccaaacacgcaccatcggtgcagatgaacgaagttcctagagacgccgaggatctt
ggagacgttgatgaggacaccaaagaagccatagacaccaagggtggatcgcagcaggcc
agagatgaacaaatacagccagagaatgaattctacgacgaggatgacaaggatgagggc
gaaaagatgatttcggttccagatgcttctattgaagtcaaagaaaagccaatcgaaagg
gctcctgctgaagaagccaaagatgtcgaagatgccaaagatgccaaagatgttccatcc
gcttccgtgttgaccaaggaagagttggacgagatcgaagagttgaacaagggtgtaaat
tag

DBGET integrated database retrieval system