KEGG   Scheffersomyces stipitis: PICST_81158Help
Entry
PICST_81158       CDS       T01023                                 

Gene name
ACC1
Definition
acetyl-coenzyme-A carboxylase (EC:6.3.4.14 6.4.1.2)
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
pic  Scheffersomyces stipitis
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    PICST_81158 (ACC1)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PICST_81158 (ACC1)
   00640 Propanoate metabolism
    PICST_81158 (ACC1)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    PICST_81158 (ACC1)
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    PICST_81158 (ACC1)
Enzymes [BR:pic01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     PICST_81158 (ACC1)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     PICST_81158 (ACC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 2224 aa AA seqDB search
MSDTSKDSSPDYTSLHEGLPEHFRGLNSIHIAEPSKVADFVKSHQGHTVITKVLIANNGI
AAVKEIRSVRKWSYETFGDEKAVQFTVMATPEDLEANAEYIRMADQFIEVPGGTNNNNYA
NVDLIVDIAERTNVHAVWAGWGHASENPLLPEKLAASAKKIVFIGPPGSAMRSLGDKISS
TIVAQHAEVPCIPWSGTGVKEVNIDPETNLVSVSDEVYQKGLCTSPEDGLIKAREIGFPV
MIKASEGGGGKGIRKVDNEDNFLALYSQAANEIPGSPIFIMKLAGDARHLEVQLLADQYG
TNISLFGRDCSVQRRHQKIIEEAPVTIANKDTFHQMENAAVRLGKLVGYVSAGTVEYLYS
HAEDKFYFLELNPRLQVEHPTTEMVTGVNLPAAQLQIAMGIPMHRIRDIRTFYGVDPHTA
TDIDFEFSTETSLITQRRPVPKGHTTACRITSEDPGEGFKPSGGTLHDLNFRSSSNVWGY
FSVSNQSSIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSIRGDFRTTVEYLIKLLET
PDFEDNTITTGWLDELISKKLTAERPDPLIAVVCGAATKAYIQSEDEKREYIQSLEKGQV
PNKNLLKTIFPVEFIYEGQRYKFTATKSSADNYTLFLNGTRGIVGVRQLSDGGLLVNIGG
KSHSVYWKEEAAATRLSVDGKTCLLEVENDPTQLRTPSPGKLVKYLVESGETVVAGQPYA
EVEVMKMCMPLITQENGVVQLIKQPGSTVSAGDILAILALEDPSKVKHAKPFEGTLPEMG
EPNVQGTKPAHKFSQYASILRNILAGYDNQVILNSTLKNLIEVLQDRELPYSEWAVHISA
LHSRLPPKLNESLTALIDRTCSRQADFPARQILKQIQKVANEPTTDSLFKDVVAPLVEIA
TRYEDGLVEHEYNFFAGLIKEYFEVESLFSGRNVREDDVVLKLRDENKTDLSKVIAVCLS
HSRVSAKNNLVLAILEAYQPVLQSSSSAAASIKQSLRQVVELDTRGTAKVALKAREILIQ
CSLPSIQERSDQLEHILRSAVLETSYGEIYAKHREPKLEIIQEVVDSKHTVFDVLSQFLV
NADEWVSIAAAEVYVRRSYRAYSLGPINYHFHDRLPIIEWKFQLPSMAASEYNSVQPTKG
DSSQPQMNRAASVSDLSFVIDSKSDLKTRTGILVPAKHLDDVDEMLAAALEKVQPSDAIS
FRTSGANQPGLMNVVNVVVTDIDGYDNEEEVLNRVQEILDEFREDLNAAAVRRITFVFAH
KVGTYPKYYTFNAPEYTENKVIRHIEPALAFQLELGRLVNFDIKPIFTDNRNIHVYEAVG
KNAPADKRFFTRGIIRTGVIRDEISISEYLIAESNRLMSDILDTLEVIDTSNSDLNHIFI
NFSNVFNVQPEDVEAAFGSFLERFGRRLWRLRVTSAEIRIVCSDKSGISFPLRAIINNVS
GYVVKSELYMEVKNTKGDWVFKSIGHPGSMHLRSISTPYPAKESLQPKRYKAHLMGTTYL
YDFPELFRQAVLSQWKKYAKSKIPKDVFTSLELINDENGKLTAVEREPGSNKIGMVGFQV
TAKTPEYPRGRQFIIIANDITHKIGSFGPEEDGYFNKCTELARELGIPRIYLSANAGARL
GIADELVPLFKVAWNVEGQPEKGFKYLYLSPEDRKSIDEAGKADTVETERIVEEGQERHV
IKAIIGAENGLGVECLRGSGLIAGATSRAYKDIFTITLVTCRSVGIGAYLVRLGQRAIQI
EGQPIILTGAPAINKLLGREVYSSNLQLGGTQIMYQNGVSHLTATDDLAGVEKIIEWLSY
IPAKRGMPVPILESEDPWNRDIEYYPPRSEPYDVRWMIQGRTLDNGEFESGLFDKDSFQE
TLSGWAKGVVVGRGRLGGIPIGIIGVETRTVDNLFPADPANADSAEMLIQEAGQVWYPNS
AFKTAQAINDFNNGEQLPLMILANWRGFSGGQRDMYNEVLKYGSFIVDALVDFKQPIFTY
IPPTGELRGGSWVVVDPTINEEMMEMYADVDSRAGVLEPEGMVSIKYRRDKLLSTMQRLD
PTYAELKKKLNDTSLSAEEHSQISAKVVAREKALLPIYQQVSVQFADLHDRSGRMLAKGV
IKKEIKWVDARRFFFWRLRRRLNEEYVLRLIGEQVKNASKLEKVARLKSWMPTVDYDDDE
AVSTWIEDHHTKLQKRIEELKQESTRQNINKLVHDDPENGIAALKDLISSLPDDEKAEFL
KSLK
NT seq 6675 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacacatccaaagattcctcgcctgactacacgtcgttgcacgaaggtttgccc
gagcactttcggggtttgaactcgattcacatcgccgaaccctcgaaagtcgctgacttc
gtcaagtctcaccagggacacaccgttatcaccaaagtgttgattgccaacaacggtatt
gctgccgtcaaggagatcagatcggtgagaaaatggtcctatgagacctttggcgacgaa
aaagccgtccagttcaccgtgatggccactcccgaagatttggaagccaatgctgagtac
attcgtatggccgaccagttcattgaggttcccggtggaaccaacaacaacaactacgcc
aatgtcgacttgattgttgacattgccgaaagaaccaacgtccacgccgtttgggctggt
tggggtcacgcatcggaaaacccacttttgcctgagaagttggctgcttcggctaagaag
attgtcttcattggtcctccaggttcggccatgagatcacttggtgataagatctcctcc
accatcgtagctcaacacgccgaagtgccatgtattccttggtctggtaccggtgttaag
gaggtgaatatcgatcccgaaaccaacttagtctctgtctctgacgaagtttaccagaag
ggtttgtgtacttctcctgaagacggtttgataaaggctagagaaatcggctttccggtc
atgatcaaggcatctgaaggtggtggaggtaagggtattagaaaggttgacaacgaagac
aacttccttgccctctacagtcaagcggctaacgaaatacctggttctcccatcttcatc
atgaagttggctggcgatgccagacatttggaagtgcagttgttggctgatcagtacggt
acaaacatctccttgttcggaagagactgttcggtacaaagaagacatcaaaagatcatc
gaagaagctcctgtaaccattgctaacaaggatactttccaccaaatggaaaatgctgcc
gttagattgggtaagttggtcgggtatgtttccgctggtacagtcgaatatctttactcc
cacgctgaagacaagttttacttcttggaacttaacccaagattgcaagttgaacatcca
accactgaaatggtcactggtgtcaacttaccagctgctcaattgcaaattgctatgggt
atccctatgcacagaatcagagatatcagaaccttctacggtgtggaccctcacactgcc
actgacatcgactttgagttcagcactgaaacctcgttgataactcaaagaaggccggtt
ccaaaaggccatactactgcctgtcgtatcacctcggaggatccaggtgaaggctttaag
ccatcaggcggtactttgcacgatttgaatttcagatcctcttccaatgtttggggttac
ttctcggtcagtaaccagtcttccatccactctttctccgactcccaattcggacacatc
ttcgcctttggtgagaaccgtcaagcttccagaaagcacatggtagttgctttgaaggaa
ttaagtattagaggtgattttagaaccaccgttgaatacttgatcaagttgttggaaact
ccagatttcgaagacaacactattactactggttggttggatgagttgatcagcaagaaa
ttgacagctgaaagacctgatccgcttatcgctgttgtctgtggtgctgctaccaaagcc
tacattcaatctgaagatgaaaagagagaatacattcaatccttggaaaagggccaagtt
ccaaacaagaacttattgaagaccattttccctgttgaattcatctatgaaggtcaaaga
tacaagttcactgctacaaagtcctctgctgacaactacaccttgttcttgaacggtacg
agaggtattgttggagttcgtcaattatctgacggtggattgttggttaatattggtggt
aagtctcattccgtatactggaaggaagaagccgctgccacaagattgtcagttgacggt
aagacatgtttgcttgaggtcgagaatgacccaactcaattgagaactccttctccaggt
aagttagtcaagtatttggttgaaagcggtgaaacggttgttgctggtcaaccatatgct
gaggttgaagtcatgaagatgtgcatgccattgattacccaagaaaatggtgttgttcaa
ttgatcaagcaaccaggctctactgttagtgctggtgacatcttggctatcttggcccta
gaagatccatcaaaggttaagcatgctaagcctttcgaaggaactttacctgaaatgggt
gaaccaaacgttcaaggaaccaagcctgcccacaagttcagccaatacgcttctattttg
aggaacattttagccggttacgataaccaagttatcttaaactccactttgaagaacttg
atcgaagtcttgcaggacagagaattaccttactctgaatgggctgttcacatttctgcc
ttgcactccagattacctcctaagttgaatgagtccttgactgccttgattgacagaact
tgttctagacaagctgatttcccagctcgtcaaattttgaagcaaattcaaaaggttgcc
aatgaaccaactaccgattccttatttaaagacgtggttgctcctttggttgaaattgca
acccgatatgaagacggcttggtcgaacacgagtacaatttctttgcaggcttgataaaa
gagtacttcgaagtagaaagcttgttctctggtagaaatgtcagagaagatgacgttgtc
ttgaaattaagagacgaaaataagacagacttgagcaaggtcattgctgtctgcttgtcg
cactccagggtcagcgccaagaacaacttggttttggcaatcttggaggcttatcaacca
gtattgcaatcatcctccagtgctgctgcatctattaaacaatctttgagacaggttgtt
gaattggatactagaggcacagctaaagttgccttgaaggccagagaaatcttgattcag
tgttctttgccttccattcaagaaaggtctgaccaattggaacacattttgagatctgct
gtcttggaaacctcttatggtgagatttatgcaaagcacagagaacctaagttggaaatc
atccaggaagttgttgactctaagcatactgtgttcgatgtgttgtctcaattcttggtc
aacgctgatgaatgggtttccattgccgctgctgaagtctacgtcagacgttcttacagg
gcctactctttggggccaattaattaccacttccacgatagattgccaatcattgaatgg
aagttccaattgccaagcatggctgcttctgaatacaattctgttcaaccaaccaagggc
gattcttctcagccacaaatgaacagagctgcctctgtttcagacttatctttcgttatc
gattccaagtctgacttgaagactagaacgggtatcttggttccagctaagcatttggat
gatgttgatgaaatgcttgctgctgctttggaaaaggtccaaccttctgatgctatcagc
ttccgtacctctggtgctaaccagccaggtttgatgaacgttgtcaacgttgttgttact
gacattgatggttacgacaatgaagaagaagtcttaaacagagttcaagaaattcttgat
gaattcagagaagacctaaatgctgctgcagttcgtcgtatcacatttgtcttcgctcac
aaagtcggtacttacccaaagtattacactttcaacgccccagaatacaccgaaaacaag
gttattcgtcacatcgaaccagccttggctttccaattggaattaggaagattagtaaac
tttgacatcaagccaatttttaccgacaacagaaacattcacgtttacgaagccgttggt
aagaatgctccagctgataagagattctttactagaggcatcatcagaactggtgttatt
cgtgacgaaatcagcattagtgaatacttaattgccgaatcaaatcgtttgatgtccgat
attttggacactcttgaagtcattgacacctctaactctgatttgaaccacatcttcatc
aacttttccaacgtattcaatgttcaacctgaggatgttgaagcagccttcgggtctttc
ttggaaagatttggtagaagattgtggagattgcgtgttaccagtgctgaaattcgtatt
gtttgttctgataagagcggtatttcattcccattgcgtgccataatcaacaacgtttct
ggttatgttgtcaagtccgaattgtacatggaagtcaagaacaccaagggtgactgggtt
ttcaaatccattggtcatcccggttccatgcacttgagatcaatctctactccataccca
gctaaggaatccttgcaaccaaaacgttacaaggcccatcttatgggtacgacttatctc
tacgattttccagaattgttccgtcaagcagttctttctcaatggaagaaatatgctaaa
tccaagattcctaaggatgttttcacatctttagaattgatcaatgacgaaaatggtaag
ttgaccgctgttgaaagagaaccaggctcgaacaaaatcggtatggttggtttccaggtc
acagctaagactccagaatatccacgtggtcgtcaattcattataattgccaatgatatc
acccacaagattggttcattcggtccagaagaagatggatacttcaacaagtgtactgaa
ttggccagagaattgggaatcccaagaatctacctttctgctaacgctggagctagactt
ggtattgccgacgaattggttcctttattcaaggttgcttggaatgttgagggtcaacca
gaaaagggtttcaagtatttatacttgtctcccgaagacagaaaatcaattgatgaagct
ggcaaagctgatactgtagaaactgagagaatcgttgaagaaggtcaagaacgtcatgtt
atcaaggctatcattggtgctgaaaatggtttgggtgtcgaatgtcttagaggttccggt
ttaattgccggtgctacctcgagagcatacaaggatatcttcactattactttggtcacc
tgtagatccgttggtattggtgcttacttagtgagattgggccaaagagctattcaaatc
gagggccaaccaatcatcttgactggtgctccagctatcaacaagttgttgggtagagaa
gtttactcctctaacttgcaattgggtggtacccaaattatgtaccaaaacggtgtctct
cacttgactgctacagatgacttggctggtgtggaaaagataattgagtggttgtcttat
attccagccaagcgcggtatgcctgttccaatcttggaatctgaagacccatggaacaga
gacattgaatactatccaccaaggagtgagccatacgacgttcgttggatgatccaaggt
cgtaccttggacaacggcgaatttgaatctggtttgtttgataaggattccttccaggaa
accttatctggttgggctaagggtgttgttgttggtcgtggtcgtttgggtggtattcca
attggtatcattggtgttgaaactagaactgttgacaacttgttccctgctgatccagct
aacgctgactctgctgaaatgttgattcaagaagctggtcaagtttggtaccctaactct
gcttttaaaactgctcaagcaatcaacgacttcaacaacggtgaacaattgccattgatg
atcttggcaaactggagaggtttctccggtggtcaaagagatatgtataatgaagttctt
aagtacggttctttcattgttgatgccttggttgatttcaagcaaccaatcttcacttac
attccaccaactggtgaattgagaggcggttcttgggtcgttgttgacccaaccatcaac
gaagaaatgatggaaatgtatgccgacgttgactctagagcaggtgtcttggaaccagaa
ggtatggtcagtatcaagtacagacgtgataagttgttgagtacgatgcagagattggat
ccaacttatgctgaattgaagaagaagttgaatgataccagtttgtctgctgaagaacac
tctcaaatctctgctaaggttgttgctagagaaaaggcattattgccaatttaccaacaa
gtttctgttcaatttgctgacttacatgataggtctggtcgtatgttagccaagggagtc
attaagaaggaaatcaagtgggttgatgctagaagattcttcttttggcgtttgcgtcgt
cgtttgaacgaagaatatgtcttgaggcttattggtgaacaagttaagaacgccagcaag
ttggaaaaggttgccagattgaagagctggatgccaactgttgactatgatgacgacgaa
gctgtcagcacctggattgaagatcatcataccaagttgcaaaagagaattgaagagttg
aagcaggaatctactcgtcaaaatatcaacaagttggtgcatgacgatcctgaaaacggt
atcgctgctttgaaggacttaatcagttctttgcctgatgatgaaaaggctgaattcttg
aaatcgcttaaatga

DBGET integrated database retrieval system