KEGG   Scheffersomyces stipitis: PICST_81177Help
Entry
PICST_81177       CDS       T01023                                 

Gene name
PDX1
Definition
pyruvate dehydrogenase complex protein X (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pic  Scheffersomyces stipitis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:pic01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pic00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:pic00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pic00620]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 418 aa AA seqDB search
MLRAVYAARKTGGSKILVAARGLHHSAPTMAAQVFTMPAMSPTMSEGGIVSWKFKPGEAF
NSGDVLLEVETDKATIDVEAVDDGKMWEIIVNDGAKGVAVGEPIALLAEPEDDLSTLERP
VLETKATKPAETAEAPKAVKTEEPVASKTPAAPKTSGSTEIFAQANVSQKLSPAVELLLH
ENDISVEDALGSIPASGPKGRLLKGDVLAHLGSISKDSIIKVTEFIKSREHLDLSNIKAE
AAAPKPEAKAPAPEPVKPKNVLTVELTSALDGDISKEKFKYAFERSIEVAIRQTYGRKFP
QYATSPVGSSLTAADDLFDDLLTPSVTKSRFEVYGINYKFFGPSLAAPSKAQSIASDFDE
LLGLTSSSPAYVEEGSAKVNVEFKIKFDEKLSDSKDFVSVFEDSLLSQIPANKLKISN
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgttgagagccgtttacgcagctagaaagaccggcggatcgaagatacttgtcgccgct
agaggcttgcatcattctgctcctacaatggcggcacaggtatttaccatgcctgccatg
tctcccacgatgagcgaaggaggaattgtcagctggaagttcaagcctggtgaagcattc
aattctggcgatgttctcttggaagttgaaaccgacaaggctaccattgatgtagaagct
gtagacgatggtaaaatgtgggagattattgtaaatgacggtgccaagggtgtagctgta
ggtgaacctattgctttgcttgctgaacctgaagatgacttgctgactttggaaagacca
gttttagaaaccaaggctacaaagcctgcagaaacagcagaagcaccaaaggcagtcaaa
actgaagaacctgtagcttccaaaactcctgctgctcctaaaacttctggctctactgag
atttttgcccaggcaaatgtatcacagaagttatcaccagcggtcgaattgttattgcac
gaaaacgacatttccgttgaagatgctttgggttctattccagcctcgggtccgaagggt
agattgttgaagggtgacgttttggcccatttgggttccatcagtaaagactctattatc
aaagttactgaatttatcaagtctagggaacacttggatttgtccaatattaaggccgaa
gctgctgctcctaagcctgaagcaaaagcccctgctccagaaccagttaagcctaagaat
gtcttgaccgtagaattgacttcagctttggatggagatatctccaaggaaaagtttaaa
tatgcatttgaaagatcaatcgaggtcgccattagacagacgtacggccgcaagttccca
cagtatgctacatcgcctgtgggctcttcgttgacagccgccgatgatctcttcgacgat
ttgctcacaccttctgtaacaaagtccagatttgaagtctacggcatcaactacaaattc
tttggtccaagcttagcagccccatcgaaagcacagagcattgccagcgattttgatgag
cttttgggcttgacgtcgtcatctccagcttatgtagaagaaggcagtgctaaggtcaat
gtcgaattcaagatcaagtttgacgaaaagttgagcgactcaaaggattttgtgtccgtg
ttcgaggactcacttctctcacaaatcccagccaataagttgaagatctccaactga

DBGET integrated database retrieval system