KEGG   Scheffersomyces stipitis: PICST_81210Help
Entry
PICST_81210       CDS       T01023                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
pic  Scheffersomyces stipitis
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:pic00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PICST_81210
Translation factors [BR:pic03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    PICST_81210
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 208 aa AA seqDB search
MSEELTAQTEELSLESKTVFDNKEEFTAKHPLSNRWTLWYTKPQVNKNENWHDLLKPVIT
FSSVEEFWGIYNSIPVANQLPLKSDYHLFKEGIRPEWEDEQNAQGGKWQYSFNNKRDAAG
VINELWLRGLLSVIGETIEDDENEVNGIVLNIRKQAFRVGIWTKDCDVNKLKTVGERLKK
VLQLREEQKVEFISHDASNKKGSASIVL
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaagaattaactgctcaaaccgaagaattgtccttggaatccaagactgtgttc
gacaacaaggaagaattcactgccaagcacccattgagcaacagatggactttgtggtac
accaagcctcaagttaacaagaacgaaaactggcacgacttgttgaagcctgtgatcacc
ttttcgtctgtagaagagttctggggaatttacaactcgattccagtagccaaccaattg
cctttgaagtcagactaccacttgttcaaagaaggaatcagaccagaatgggaagacgaa
cagaatgcccaaggtggtaaatggcaatactctttcaacaacaagcgtgacgctgctggc
gtcatcaacgagttgtggttgcgtggattgttgagtgtcattggtgaaactatcgaagac
gacgaaaacgaagtcaacggtatcgtgttaaatatcagaaagcaagccttcagagtcgga
atctggaccaaagattgcgacgtcaacaagttgaagaccgtaggtgaaagattgaagaag
gtgttgcaattgagagaagaacaaaaagtcgagttcatctcccacgatgcatccaataag
aagggttctgcttccattgtcttgtaa

DBGET integrated database retrieval system