KEGG   Scheffersomyces stipitis: PICST_81231Help
Entry
PICST_81231       CDS       T01023                                 

Gene name
GSY1
Definition
glycogen (starch) synthase (EC:2.4.1.11)
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
pic  Scheffersomyces stipitis
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PICST_81231 (GSY1)
Enzymes [BR:pic01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     PICST_81231 (GSY1)
Glycosyltransferases [BR:pic01003]
 Polysaccharide
  Storage polysaccharide
   PICST_81231 (GSY1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 699 aa AA seqDB search
MTRDITNHLLFEVATEVAHKVGGIYSVLKSKAPITVAEYRERYTLIGPLNYNSAQIEVEE
LPVKDPLIKQTLDSMSERGIRWLYGRWLIEGAPRVLLFDIWSAGHHLNEWKSDLWNIAGI
PTPDHDQESNDAILLGYLVAWFLGELVYNDRERAVICQCHEWLAGIALPLCRKRRIDVTT
IFTTHATLLGRYLCAGSTDFYNNLANFDVDAEAGKRGIYHRYCMERSATHSADVFTTVSH
ITAYEAEHLLKRKPDGVLPNGLNVVKFQAVHEFQNLHAIKKAKINEFIKGHFYGNYDFDL
DNTLYFFIAGRYEFRNKGCDFFIEALARLNHRLKEAGSKMTIVAFIIMPGKTHSYTVETL
KGQAVIKQLESTIEEVQKKVGERLFEHCARFPNANNKSNTEVPSIDELIKPADRVLLKRR
IFALKREGLPPIVTHNMAEDATDPILNQIRRVQLFNKPEDRVKIIFHPEFLNANNPILSL
DYDEFVRGCHLGVFPSYYEPWGYTPAECTVMGVPSVTTNLSGFGCYMEDLIENTSDYGIY
IVDRRMKSVDESINQLTDYMYNFAEKTRRQRINQRNRTERLSDLLDWKRMGLEYIKARQL
SLKRAYPDKFKNGANPFNNQSNLKLTRPLSVPGSPRGKVGLMTPGDLGSLQEAQESLNTE
DYIGFKLGATDDVDDDDDEHPHYPLTLRGTSAPPQEESA
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgaccagagatattacgaaccatctcctctttgaagtggccaccgaggtcgctcacaag
gttggtggaatttattcggtgttgaagtccaaagctcccatcactgtggccgagtaccgg
gaaagatacactttgattggtccattaaactacaattcggcccagatcgaggttgaagaa
ttgcctgtaaaggatccacttatcaagcagactttggactcgatgagcgagcgtggtatc
cgttggttgtacggtagatggttgattgaaggtgcccctcgtgtcttgttgtttgatatc
tggtctgcaggccatcacttaaacgagtggaagtctgatttgtggaacattgctggaatt
ccaactccagatcatgaccaggaaagtaatgatgccattctccttggttacttggttgct
tggttcttaggtgaattggtctacaacgaccgtgaaagagccgtaatctgtcaatgtcac
gaatggttggctggtatagccttgcccttatgtagaaagagaagaatcgatgtcactacc
atcttcaccacccacgctacactcttgggaagatacttgtgtgctggctctaccgatttc
tacaacaatttggccaattttgatgttgatgccgaggcaggaaagcgtggtatttaccac
agatattgtatggaaagatcggccacacattctgccgatgtcttcactaccgtatctcat
atcacggcttacgaagctgagcatttgttgaagagaaagccagatggagttttgccaaac
gggttgaacgtcgtcaagttccaagctgttcacgagttccagaacttgcatgccatcaag
aaggcaaaaattaacgaattcatcaaaggtcatttctacggtaactacgacttcgattta
gacaacaccctctacttcttcattgcgggtagatacgagttcagaaacaagggctgtgac
ttcttcatcgaagctttggccagattgaaccacagattgaaggaagctggctccaagatg
accattgttgcatttatcattatgcctggtaagactcattcttacactgtggaaactttg
aagggtcaagccgtcatcaagcagttggaaagcacgattgaagaagtgcaaaaaaaagtc
ggggaacgtttgttcgaacattgtgcgcgttttcctaacgccaataacaagagcaacacc
gaagttccttcgatcgacgaattgattaagccagccgatagagtgttattgaagagaaga
atcttcgcacttaagcgcgagggattaccaccaattgtcacccataacatggctgaggat
gctactgatccaatcttgaaccaaattagacgtgttcagctttttaacaagccagaagat
cgtgtcaagatcatcttccacccagaattcttgaacgccaacaacccaatcttgtccttg
gactacgatgaattcgttagaggctgtcacttaggtgtttttccatcctactatgaacct
tggggttacactccagctgagtgtactgttatgggagttccatctgtcaccaccaacttg
tctggttttggatgttatatggaagatttaattgaaaacacttcggactacggtatctac
atcgtcgatagaagaatgaagtctgtggatgaatcgatcaatcaattgaccgattacatg
tacaactttgctgaaaagacaagaagacaaagaatcaaccaaagaaatagaactgaaaga
ttgtctgacttgttggactggaagagaatgggtttggaatacatcaaagctcgccagtta
tcattgaaaagagcttatccagacaagttcaagaatggtgctaatccattcaacaaccaa
tctaacttaaaattaactagaccactttctgttccaggttcgccaagaggtaaagttggt
ctcatgactcctggtgacttaggttcgttgcaggaagcccaggaatccttgaacactgaa
gactatatcggtttcaagttgggcgctactgatgacgtggatgacgatgatgacgagcat
cctcactatccattgacattaagaggtacctctgctccaccacaagaagagtctgcctaa

DBGET integrated database retrieval system