KEGG   Scheffersomyces stipitis: PICST_81803Help
Entry
PICST_81803       CDS       T01023                                 

Gene name
YAK1
Definition
serine-threonine protein kinase
Orthology
K18670  
dual specificity protein kinase YAK1 [EC:2.7.12.1]
Organism
pic  Scheffersomyces stipitis
Brite
Enzymes [BR:pic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     PICST_81803 (YAK1)
Protein kinases [BR:pic01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   PICST_81803 (YAK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 704 aa AA seqDB search
MSEDSVCVEDEFSRININKSPTRRKKVYPQNLYPPQNQIYFPPPDPPSTATSPSSTSDTN
NTSNTINNNTIITNNVIANTIKKKSLSTTKIHPSDKRLLSYPMSEKAASKQDYQFSFMRE
TSSSIQKKHSTYSGGLSKPNQPYLTTGSATKKRLEYSRQLSHNLRSRRLLSSNFPSKTSP
SDITNLPYSLPAKYGGMPGEDSPTKQKVIRNASQPLPLKSVNNVFNRLYPNSLESEVKPR
VAPEKVGMENKDINSVKVNDITELFSILYAFDEQLFPNEGDSDCPEAKPIQAVELAKLKM
NIYERGEIIRKQQLYFVPQGIERNLNIKNYQNNFGFDDANGNYIIVEGDHINYRFEVLKM
LGNGSFGNVIMSKDHKYSSRLVATKIIKNDLNWSLQAINEIKMLRLLNEKETNENILKYY
DHFNFRSHMCIVTELLSINLYSLLEVSQFRGFSLNIVQSITKQILNGLQYMHRLNVIHCD
IKPENIMIQLPHSPQVGTFVVKIIDFGSSCLSNEISFTYIQSRFYRAPEVIIGANYTEGI
DVWSLGCVIAELFTGVPLLPGKNEIEQVGLILELFGAPKSTTILRLRKSLTRSVQKKSFE
MNENSPHVNEKLIKKTLLFRLFDINGKINMSLLNYHNANSTAYSAKKQFKLNSRNLEIYL
SLNKCPSQLNKSFLRFLQKIFVWDPVERSSILQLTEEPFVTSQD
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaggatctggtctgtgtcgaagatgagttctcacgtataaacatcaacaagtcg
cccacaagacgaaaaaaagtctacccacaaaacctttatcctcctcagaaccagatatat
ttcccccctccagatccgccatccacggctacctcaccatcctccacatcagatacaaac
aatacaagtaacactatcaacaataacaccatcattactaataatgttattgctaacact
attaaaaagaagtcattatccactacgaaaatccatccgtcagacaaaagactactaagc
tatccgatgtctgaaaaagcagcttcgaaacaagactaccagttttcatttatgagagaa
acatcgtcttctatccagaagaaacacagcacatactcgggtggactctccaaaccaaat
cagccgtatcttacgactggttctgccactaaaaaacgcctcgaatactcaagacaactt
tctcataatctccgatcaagaagattgttgtcttcgaattttccttcgaaaacactgcct
tcggacatcaccaatttgccctactccttacccgctaagtacggaggaatgccgggggaa
gactcgcctacaaagcaaaaggtaatacggaatgcgtcgcagccacttccgttaaagtca
gtcaataacgtgttcaatagactctatcctaatagcttggaatctgaagtgaaaccacga
gtagctcctgagaaagtaggtatggaaaacaaagatatcaacagtgtgaaagttaacgat
attacggaactattctccatattatatgcgtttgatgaacaactctttcccaacgaagga
gattcggattgtccagaagcgaagccaatacaggcagttgagcttgctaagctcaagatg
aatatctatgaaaggggagagatcatccggaaacagcaactttattttgtgccacaagga
atagagagaaatttgaatatcaagaactatcagaataactttggttttgatgatgcgaat
ggaaactacattatcgtcgaaggagatcacatcaactatcgttttgaagtgttgaaaatg
ttgggcaatggatcatttggaaacgtgataatgagcaaagatcacaaatattctagtcgg
cttgttgctactaaaatcattaagaacgatcttaattggtccttgcaagctatcaacgaa
ataaaaatgctcagactattaaatgaaaaggaaacaaacgaaaacatccttaagtactac
gaccattttaatttcaggagtcatatgtgcattgtcacagaattattgtctataaacctt
tactcattgctagaagtaagtcagttcagaggattctccttgaatattgttcaatcaata
acaaagcaaatcttgaatggtttgcaatatatgcatagactcaatgttatacattgtgat
ataaagcccgaaaacattatgatccagttgccacatctgccacaagttggtacttttgtc
gttaagataattgattttggatcatcgtgcttaagtaatgaaatttcattcacgtatatc
cagtcaagattctacagagcaccagaagtcatcataggtgccaattataccgaaggaatt
gatgtttggtccttaggctgtgtcattgctgaactttttactggtgttcctctattgcca
ggcaagaacgaaatagaacaggtaggattaattctagaattgttcggagcaccaaaaagt
acaactatcttaagattgaggaagtctttgacaaggtcggttcaaaagaagtctttcgaa
atgaacgaaaatagtccccatgtcaatgaaaagctaataaagaaaacgctattgttcagg
ttgtttgacattaatggaaaaatcaatatgtcgttgcttaactaccataatgccaactca
acagcgtattcggctaagaagcagtttaagttaaattccagaaacttggaaatatatttg
agtttgaacaaatgtccctcgcagttgaacaagctgttccttcgtttccttcagaagata
tttgtatgggatcccgttgaacgttctagtattttgcagttgacggaagaaccgtttgtc
acttctcaagattaa

DBGET integrated database retrieval system