KEGG   Scheffersomyces stipitis: PICST_82300Help
Entry
PICST_82300       CDS       T01023                                 

Definition
hypothetical protein
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
pic  Scheffersomyces stipitis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 516 aa AA seqDB search
MSGGENNQDSHSPDPSAPIAIKAGKDEPAADDQFIEDEIIIGCKVYVSKDGEHRLAEILQ
QHLKKGKKVFYVHYQEFNKRLDEWISSDRIDYRRPMILPEVKADKKEEKKDSKSKKKTSK
PKSSKAASKLAQSSSGAGTPQAEDSENMETPGQEDEMDLDDLNVQGLKRPGEEVNREDEI
KKLRTSGSMTQNHSEVARVRNLSRVILGEHIIEPWYFSPYPIELTEEDEIYICDFTLSYF
GSRKQFERFRSKCCLKHPPGNEIYRDSKVSFWEIDGRRQRTWCRNLCLLCKLFLDHKTLY
YDVDPFLFYVMTIKSEQGHHVVGFFSKEKESGDGYNVACILTLPCYQKRGYGKLLIQFSY
MLSNVEHKVGSPEKPLSDLGLLSYRAYWTDTLVKLLVERSNPMLYKKNNPAIDEDEDGGS
TPPANTNKPGSVNEITIEEISALTCMTTTDILHTLTTLQILRYYKGQHIIVITDQIMTLY
EKLVKKVKDKKKHELEPRRLKWTPPLFTANQLRFGW
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgtccgggggcgagaacaaccaagactcgcattcgcccgatcccagcgcgcctatagcg
attaaagcaggcaaagatgagccagcagctgatgatcagttcatagaagatgaaatcatt
ataggatgtaaggtgtatgtttccaaggatggagagcacagactagcagagattcttcag
caacatttgaagaagggcaagaaggtattctatgtacactatcaagagttcaacaagcgt
ttagatgaatggattctgagcgaccgaatcgactaccgtaggccgatgatcctcccagag
gttaaggctgataagaaagaagagaaaaaagatctgaaactgaagaaaaagacgtctaag
cccaagagctcgaaggcggcttcaaagcttgctcagctgtcttcgggagctggtactccc
caggctgaagatagcgaaaatatggaaaccccgggccaggaagatgaaatggatcttgat
gacttgaacgttcaaggattaaaaagaccaggagaagaagttaaccgcgaagacgagatc
aaaaaattaagaacaagtgggtccatgacccagaaccatctggaggtggcccgagttaga
aatttatccagggtcatcttgggagaacatatcatagagccgtggtacttttcgccatac
cccatagaattgaccgaggaggacgaaatatacatctgtgacttcacattgtcgtatttc
gggtctagaaaacagtttgaacggttcagatccaaatgctgcttgaaacacccgcccgga
aatgagatctacagggactctaaggtttctttctgggagatagacggtagaagacagcgt
acttggtgtcgtaatctttgtttgctttgcaaactcttcttagaccacaagacgttgtac
tatgatgtagatccgttcttattctacgttatgaccatcaagtcagaacaaggacatcat
gttgttggcttcttttccaaggaaaaagaaagtggcgatggatataacgtagcgtgcatt
ctcaccttgccttgttaccagaaacggggctacgggaagttgcttatccagttctcgtat
atgttgtcgaatgtggaacacaaagtaggatctcccgaaaagcctctatccgacttgggc
ttgttgtcgtacagggcctattggacagatacattggtcaaattgcttgtagagagaagt
aatccgatgttgtacaaaaagaacaaccctgccattgatgaagacgaagacggtggatct
actcctcctgccaataccaacaaaccaggcagcgtaaacgagattacaatcgaagaaatc
tcggctcttacttgtatgactacgacagacattcttcataccttgacgacgttgcagatc
ttacgctactataaaggtcaacatatcatcgtgatcactgaccagatcatgacgttgtac
gagaagctcgtcaagaaggtcaaggacaagaagaaacacgagttggagcctcgcagactc
aaatggaccccaccacttttcacagctaaccaattaaggttcggatggtag

DBGET integrated database retrieval system