KEGG   Scheffersomyces stipitis: PICST_82497Help
Entry
PICST_82497       CDS       T01023                                 

Definition
hypothetical protein
Orthology
K06634  
cyclin H
Organism
pic  Scheffersomyces stipitis
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:pic00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    PICST_82497
  Replication and repair
   03420 Nucleotide excision repair
    PICST_82497
Transcription machinery [BR:pic03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     PICST_82497
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 404 aa AA seqDB search
MSVGTEIKREAEENVEQPEAKKKRISNDDLFRRSTQFEIWSYTQESLDKTKRAANAAGAK
IATQKFNETFETIEKEQPEVFQTHNETLNKDKLLTLLSFEEEAKYLNYYTQNIIPIAKFF
KMPTQVKLTAVSFFRKFYLSNSVMQYHPKNIMYTSVFLAAKSENYFISIDSFIKALKDTE
AKDILDLEFIILQSLQFTLLVHHAFRPLYGFFLDFQAVLLHPSPLMYDVSVNTLGSLYDK
AKTWLNDNVVLSEVAFLFTPPQIALAAMYEVDKRITDRYLKRKFLKEHHELDAIKEEDSG
VKKEDSEVIEKIESTESVENGEDKKDGENETANEHKEKSTVESQREQYETLVRTIRKCIK
IAKQVQTSSREEVKEIDRKCFYALNPKRLIEKQVKKVTKEATTS
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtaggcacagaaataaaaagggaagccgaggagaatgtagaacaaccggaagcc
aaaaagaaacggatttccaatgacgatttgttcagaagatccacccaatttgagatctgg
tcatatactcaagaatctctagacaagaccaagcgggctgccaatgctgctggagccaag
atagcgacacagaagttcaacgaaacatttgaaacaatcgaaaaggaacagcctgaagtt
tttcagacacataacgagactttgaataaagataagttgcttacattgctcagtttcgaa
gaggaagcaaagtacttgaattactacacgcagaatattatccccatagccaaattcttc
aagatgcccacccaggtgaaattgacggcagtgtcgttcttcagaaagttctatctttcc
aattcggtcatgcaataccatcccaagaatatcatgtatacgagtgtattcctagcagca
aagtcagaaaactatttcatctctatagattcattcatcaaagcgttgaaagatactgaa
gctaaagacattttagatcttgaatttatcatcttgcagagcttacagtttacattgctt
gtgcaccacgcctttcgtccattgtacggattctttcttgatttccaagctgtgctattg
cacccatccccattgatgtatgacgtatcggtcaacacgttaggaagcttatacgataaa
gcaaagacatggctaaacgacaatgtggtgcttagcgaggtcgcattcttatttactcca
ccacagatagctcttgctgccatgtatgaagtagataaaagaatcacagatagatacttg
aagagaaagttcttgaaggaacaccacgaacttgatgctatcaaagaagaagattctgga
gttaagaaagaagattcggaagtaattgagaagattgaaagtaccgaaagtgtagaaaac
ggcgaagacaagaaggatggagaaaacgaaacagctaatgagcacaaagaaaagtctaca
gtggagagtcaaagagagcagtatgagactttagtgaggacaatcagaaagtgtatcaag
atagcgaaacaggttcagacatcctctcgtgaagaagtgaaggagattgaccgtaaatgc
ttctatgctttgaaccctaagagattgatagagaaacaggtgaaaaaggtcaccaaagaa
gccaccacttcatag

DBGET integrated database retrieval system