KEGG   Scheffersomyces stipitis: PICST_82622Help
Entry
PICST_82622       CDS       T01023                                 

Gene name
DFR1
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
pic  Scheffersomyces stipitis
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PICST_82622 (DFR1)
   00670 One carbon pool by folate
    PICST_82622 (DFR1)
Enzymes [BR:pic01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     PICST_82622 (DFR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 203 aa AA seqDB search
MSEIKPTIAIIVAALKPDLAIGFQGKMPWRLRKEIRYFKDVTTKTSDPSKINAVVMGRKT
WDSIPARFRPLPDRINIVLSRSFQNETVDTNVIHANSIANSLSQLQPNVERVFVIGGAEI
YNELINDSRVTHLLLTEIENTNEDNQIAVDTFLKFPLYSTDSQWRKQPKSELQKFIGSSI
TLEDDISEGDLKYNYTLWTRRAG
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagatcaaacctactatagccatcatagtggctgccctaaagccagatcttgcc
atagggttccaaggtaaaatgccctggaggttacggaaagagatccgctacttcaaggac
gtcaccaccaagacctcagatccatctaagatcaatgctgtggtgatgggacgaaagacg
tgggattcgattccagctagattcagacctttaccagatagaatcaatattgtcctctcg
cgatcgttccagaacgagactgttgacaccaacgtgatacacgccaactccatagcaaac
tcacttagtcagttgcagccaaatgtcgagagagtcttcgttatcggtggagcggaaatc
tacaatgaattgattaacgattcgagagtgacccatttactactcacagaaatcgaaaat
accaatgaggacaaccaaatcgccgtagataccttcttgaagtttccgttgtatagtaca
gattcacaatggagaaagcaaccgaagctggaattacaaaagtttataggctcgtccatc
accttagaagatgacatttccgaaggcgaccttaaatataattacacattatggacaaga
agggctggataa

DBGET integrated database retrieval system