KEGG   Scheffersomyces stipitis: PICST_83540Help
Entry
PICST_83540       CDS       T01023                                 

Gene name
ASN1
Definition
asparagine synthetase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
pic  Scheffersomyces stipitis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PICST_83540 (ASN1)
Enzymes [BR:pic01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     PICST_83540 (ASN1)
Peptidases [BR:pic01002]
 Cysteine Peptidases
  Family C44
   PICST_83540 (ASN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 573 aa AA seqDB search
MCGIFAAYKQPEVELFKSKALQYSKRIRHRGPDWSGNVIQNSTILCHERLAIVGLDSGAQ
PITSEDGNYTLAVNGEIYNHIQLRDEFNTYKYKSLSDCEPIIPLYEKYDVDAPKYLDGMF
AWVLYDKKADRIVAARDPIGITTLYLGKSSKNPETRYFASELKCLIDECDEVTAFPPGHV
YDSNTDQITRYFTPTWWDGSKIPSKHADLKEVRETLELAVRKRLMAEVPYGVLLSGGLDS
SLIASIAARETKKAAASVSDEGIDANKELSGVDEKGSLHFSGFTNSLHSFAIGLPGAPDL
IAAEKVAHFIGTIHHSHTFTVEEGLDALDDVIYHLETYDVTTIRASTPMYLLSRKIKAQG
VKMVLSGEGSDEVFGGYLYFANAPSAKDFHQECVQRVKDLHYADCLRANKSTMAWGLEAR
VPFLDKQFLEVCMNINPEDKLIKPAEGKIEKYVLRKAFDTSDEPDVHPYLPKEILWRQKE
QFSDGVGYSWIDGLKDAAEAAVSDEEFANPKPEWGSDIPTTKEAYWYRCKFDRVFNNSAT
AASTVMRWIPKAEWGCHEDPSGRYAATHDHKVI
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtatatttgcagcctataagcaacctgaggttgaacttttcaagtcgaaagct
ttacagtactccaaaagaatccgtcaccgtggtcccgactggtcaggtaacgtgatccag
aactctaccatcttgtgccacgagagattggccattgtcggtttggactccggtgctcaa
ccaatcacctcagaagatggcaactacaccttggccgttaacggagaaatctacaaccat
atccagttgagagacgagtttaacacctacaagtataaatcgttgtcagactgtgagccc
atcattccactttacgaaaagtacgacgtcgatgcccccaaatacttagacgggatgttt
gcctgggttctctacgacaagaaagctgaccgtatcgtagctgccagagaccccatcggt
atcactactttgtatctcggaaagagttcgaagaaccccgaaacaagatactttgcctca
gagttgaagtgtttgatcgacgaatgtgacgaggtaacggctttcccacctggtcacgtc
tacgactccaacactgatcagatcacgagatacttcactccaacatggtgggacggttct
aagattccttcgaagcatgctgacttgaaggaagtgagagaaaccttggaattagccgtg
agaaagagattaatggccgaagtgccctacggtgtgcttctttcaggtggcttggactcg
tcgttgattgcttcgatcgctgccagagaaacaaagaaggctgctgcttccgtttcggat
gaaggtatagatgccaacaaggagttgtctggtgttgatgaaaagggttcgttgcacttt
tctggcttcaccaactccttgcattcgtttgctattggtttgccaggtgccccagacttg
atcgctgctgaaaaggtagcccacttcattggaactattcaccattctcacacttttaca
gtggaagaaggtttggatgcacttgacgatgtcatctaccacttagaaacctacgatgtc
accaccatcagagcatccacgccaatgtacttactttctagaaagattaaggcccagggt
gtcaagatggtgttgtctggtgagggatcggacgaagtatttggaggctacttgtacttt
gccaacgccccaagtgctaaggacttccaccaggaatgtgtccagagagtcaaggacttg
cactacgccgactgtttgagagccaacaagtccaccatggcctggggattggaagccaga
gttcctttcttggacaaacagttcttggaagtgtgtatgaacatcaacccagaagacaag
ttgataaaaccagctgaaggcaaaattgaaaaatacgtcttgagaaaggctttcgacacc
tcggatgaaccagacgtccacccatacttgcccaaggaaatcttgtggagacaaaaggaa
cagttctccgatggtgttggttactcctggattgatggcttaaaggacgctgctgaggct
gctgtctctgacgaagaatttgccaaccctaagcctgaatggggatcagatattccaact
actaaggaggcctactggtatagatgcaagtttgaccgtgtgttcaacaactcggcaact
gctgcctccactgtcatgagatggattccaaaggctgaatggggctgtcatgaagatcct
tccggaagatacgctgccactcacgaccacaaggtcatctga

DBGET integrated database retrieval system