KEGG   Scheffersomyces stipitis: PICST_83712Help
Entry
PICST_83712       CDS       T01023                                 

Definition
hypothetical protein
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
pic  Scheffersomyces stipitis
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:pic01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:pic00062]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 329 aa AA seqDB search
MQLSTLLNVQYILGWFADQAERPAEGLRRLGQELELFPEVEDYSQWPPSTPIPKPVVLWH
GLGDNFNSSGMHKVATIFESLHPDIYVHSVQLAEDPASDEQKSFVGDANEQLDIVCKQLS
KVPQLRQGFDIVGFSQGGVFARALVERCSSISVSNLITFGAPHNGVSELPMCKDANDWLC
KNRNEVLKKSVWFDNVQKYIIPAQYFRTPKDYSSYLKYSNFLADINNERTEVNITYKRNL
SKLSKFVMVTFDDDTTLIPKDSAGFQDIDAETDAIIPFEQTIIYTRDLLGLQSLHSLGKI
DFYSIEGDHMQIPESFLVMIGVKYIGSYW
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgcagttgtctacgcttcttaacgtacagtatatacttggctggtttgccgaccaagct
gagcgaccagcagaagggttgagacgtcttggccaagaattggaacttttccctgaggta
gaagattatagtcaatggcccccaagtacacctatacccaaacccgttgttttatggcat
ggtttgggagacaatttcaattcttcaggaatgcacaaggtggccaccatatttgagctg
cttcatcctgatatatatgtccattccgtgcaattggctgaagatccagcttcagacgaa
caaaagtcatttgtaggtgatgcgaacgaacagttggacattgtatgtaagcagcttctg
aaagtacctcaattgcgccagggctttgatatcgttgggttttctcagggtggagtgttc
gccagagcattagttgaaaggtgttctctgatttcagtaagcaatttgattacatttggt
gctccccacaatggagttctggaacttcccatgtgtaaggatgccaatgactggctctgt
aagaacagaaatgaagttctcaagaagctggtctggttcgataatgtacagaaatatatc
atcccagcacaatactttcgtactccaaaggactactcgagttatttgaagtattccaat
tttttagctgatatcaacaatgaacggacagaagtcaacattacctacaagagaaactta
agtaagttgtctaagtttgtaatggttacatttgatgatgataccactttgattcccaag
gacagcgctgggttccaggatattgacgctgaaacggatgctattataccttttgagcaa
acaatcatatacacaagggatttgttgggacttcagagcttgcactctttaggtaagata
gacttctatagtattgaaggtgatcatatgcagattccagagtctttcttggttatgatt
ggggttaagtatataggttcatattggtag

DBGET integrated database retrieval system