KEGG   Scheffersomyces stipitis: PICST_83712Help
Entry
PICST_83712       CDS       T01023                                 

Definition
(RefSeq) predicted protein
  KO
K01074  palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
pic  Scheffersomyces stipitis
Pathway
pic00062  Fatty acid elongation
pic01100  Metabolic pathways
pic01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Lipid metabolism
   00062 Fatty acid elongation
    PICST_83712
Enzymes [BR:pic01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     PICST_83712
Lipid biosynthesis proteins [BR:pic01004]
 Fatty acid synthase
  Component type
   PICST_83712
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Palm_thioest Lipase_2 DUF676 PGAP1 FSH1 Thioesterase Abhydrolase_1
Motif
Other DBs
NCBI-GeneID: 4839661
NCBI-ProteinID: XP_001384924
JGI: 83712
UniProt: A3LW35
Position
5
AA seq 329 aa AA seqDB search
MQLSTLLNVQYILGWFADQAERPAEGLRRLGQELELFPEVEDYSQWPPSTPIPKPVVLWH
GLGDNFNSSGMHKVATIFESLHPDIYVHSVQLAEDPASDEQKSFVGDANEQLDIVCKQLS
KVPQLRQGFDIVGFSQGGVFARALVERCSSISVSNLITFGAPHNGVSELPMCKDANDWLC
KNRNEVLKKSVWFDNVQKYIIPAQYFRTPKDYSSYLKYSNFLADINNERTEVNITYKRNL
SKLSKFVMVTFDDDTTLIPKDSAGFQDIDAETDAIIPFEQTIIYTRDLLGLQSLHSLGKI
DFYSIEGDHMQIPESFLVMIGVKYIGSYW
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgcagttgtctacgcttcttaacgtacagtatatacttggctggtttgccgaccaagct
gagcgaccagcagaagggttgagacgtcttggccaagaattggaacttttccctgaggta
gaagattatagtcaatggcccccaagtacacctatacccaaacccgttgttttatggcat
ggtttgggagacaatttcaattcttcaggaatgcacaaggtggccaccatatttgagctg
cttcatcctgatatatatgtccattccgtgcaattggctgaagatccagcttcagacgaa
caaaagtcatttgtaggtgatgcgaacgaacagttggacattgtatgtaagcagcttctg
aaagtacctcaattgcgccagggctttgatatcgttgggttttctcagggtggagtgttc
gccagagcattagttgaaaggtgttctctgatttcagtaagcaatttgattacatttggt
gctccccacaatggagttctggaacttcccatgtgtaaggatgccaatgactggctctgt
aagaacagaaatgaagttctcaagaagctggtctggttcgataatgtacagaaatatatc
atcccagcacaatactttcgtactccaaaggactactcgagttatttgaagtattccaat
tttttagctgatatcaacaatgaacggacagaagtcaacattacctacaagagaaactta
agtaagttgtctaagtttgtaatggttacatttgatgatgataccactttgattcccaag
gacagcgctgggttccaggatattgacgctgaaacggatgctattataccttttgagcaa
acaatcatatacacaagggatttgttgggacttcagagcttgcactctttaggtaagata
gacttctatagtattgaaggtgatcatatgcagattccagagtctttcttggttatgatt
ggggttaagtatataggttcatattggtag

DBGET integrated database retrieval system