KEGG   Scheffersomyces stipitis: PICST_85252Help
Entry
PICST_85252       CDS       T01023                                 

Gene name
GLC7
Definition
protein phosphatase type I (EC:3.1.3.16)
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
pic  Scheffersomyces stipitis
Pathway
mRNA surveillance pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:pic00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    PICST_85252 (GLC7)
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    PICST_85252 (GLC7)
Enzymes [BR:pic01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     PICST_85252 (GLC7)
Protein phosphatases and associated proteins [BR:pic01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     PICST_85252 (GLC7)
Transcription machinery [BR:pic03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     PICST_85252 (GLC7)
Spliceosome [BR:pic03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    PICST_85252 (GLC7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7
AA seq 328 aa AA seqDB search
MSADHQEADIDSIVDRLLEVRGSRPGKQVTLLEHEIRYLCTKAREIFIQQPILLELEAPI
KICGDIHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFF
ILRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFTMHGGLSPD
LNSMEQIRRVMRPTDIPDVGLLCDLLWSDPDKDITGWSENDRGVSFTFGPDVVSRFLQKH
DMDLICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILKPA
DKKPRYPPSAGANNRPGATPRKPKKTGK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccgaccaccaggaagccgacatcgattccatagtcgatagattgctagaagtc
cgcggctccagaccaggtaaacaagtcaccttgttggaacacgaaatccgttacttgtgc
accaaagccagagagatcttcatccagcagcccatcttgttggagctcgaagcgccaatc
aagatctgtggcgatattcacggccagtactacgacttgttgcgactcttcgaatacggc
ggtttccccccagaagccaactacttgttcttgggagactacgttgacagaggtaaacag
tcgttggaaacgatctgtttgctcttagcgtacaagatcaaataccccgagaactttttc
atcttgagaggaaaccacgagtgtgcctctatcaacagaatctacgggttttacgacgaa
tgtaaaagaagatacaatatcaagttgtggaagacgtttaccgactgcttcaactgtttg
cccatcgccgccatcatcgacgaaaagatcttcaccatgcatggaggtttatctccggac
ttgaactccatggaacaaatcagaagagtcatgagaccaaccgatatcccagatgtgggg
ttgttatgtgacttgttatggtccgatcctgataaggatattacaggatggtcagaaaac
gacagaggtgtctcgttcacgtttggaccggacgtcgtatcgcgattcttgcaaaaacac
gacatggatttgatctgtcgtgcccatcaggtcgtagaagatggttatgagttcttctct
aagagacaattggtgacgttattctcggctcctaactactgtggtgagttcgacaatgct
ggtgccatgatgagcgtagacgaaagcttgttgtgttcgttccaaatcttaaagccagcc
gataagaagccaaggtatcctccttcggcaggcgccaataatagacctggtgctactcca
agaaagcctaagaagaccggaaagtaa

DBGET integrated database retrieval system