KEGG   Scheffersomyces stipitis: PICST_85423Help
Entry
PICST_85423       CDS       T01023                                 

Definition
hypothetical uncharacterized conserved protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pic  Scheffersomyces stipitis
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pic00010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7
AA seq 302 aa AA seqDB search
MPVEDNDSQVVLTHPEDNSTTVTILKYGANVLSWKNKGKEQLWLSEGAKVDGSKPVRGGI
PLVFPVFGKQKDANHPTFPLPQHGFARSSEWEFLGQTSANPPTVQFALSPEQVSSEALKL
WGNGDYDFTLILTVSLELDKLTTEIEVENAGEKEFEFNWLFHTYFRVPDITDTLVNNLID
QKCFDQLLAEEYVEKSPIISFHEEFDRIYKKVDYGKTFQIIEFGKVLINVVRKNLPDAVV
WNPWIKKSDGMADFLPKNGYLNMLCVEPGNVSDFVKLQKGEKWTGAQILTVGGEIKVQSN
IY
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtagaagacaacgactcccaagttgtgctcacccacccagaagataattccacc
accgtcactattcttaagtatggtgccaacgtactctcgtggaagaacaaaggaaaagaa
caactctggctcagtgaaggtgccaaggttgatggttctaaacccgtcagaggaggtatc
ccattagtcttcccggtatttggcaaacagaaagatgcaaaccatcccactttccctctt
cctcagcacggattcgccagatcttcggaatgggaattcttgggccagacttctgcgaat
cctcctacagtgcaatttgccttaagcccagaacaggtgctgtctgaagcactcaagttg
tggggaaacggcgactacgacttcacgcttatccttactgtctccttggagttggacaaa
ctcaccactgagatcgaagtggaaaacgcgggtgaaaaagagtttgagttcaactggctc
ttccacacttacttcagagttccagatatcacagacaccttggtcaacaacttgatcgac
cagaaatgctttgaccagcttttggccgaggaatacgtggaaaagtcgcctatcatcagt
ttccacgaggaattcgacagaatttataagaaagttgattatggcaaaactttccagatc
atcgagtttggtaaagttttgatcaatgtagtccgtaagaatttacctgatgctgtagtc
tggaacccttggatcaagaaatcagatggaatggctgacttcttgcctaaaaacggttac
ttgaacatgctctgtgtagaaccaggtaacgtttcagattttgtcaagttgcaaaagggt
gaaaagtggactggtgcccagatcttgacagtggggggtgagatcaaagtccagtcaaat
atctactaa

DBGET integrated database retrieval system