KEGG   Scheffersomyces stipitis: PICST_85478Help
Entry
PICST_85478       CDS       T01023                                 

Definition
hypothetical protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
pic  Scheffersomyces stipitis
Brite
Enzymes [BR:pic01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     PICST_85478
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8
AA seq 358 aa AA seqDB search
MSAIAIKPSLLRAAKTSAPRFSRAAWLAAGLVGTAGTATYLYSNSNNSNSNNSNNAGKKL
STLMAGVLGANVATVPQGKTLKDYQEVYNDIAAKIEENLDYDGGAGFYGQLVRLAWHSSG
TYDKNTKTGGSYYGTMIFYPEASDGANNGLANGRDFLYEFAVKYPWISRGDLWTLGGVVA
VQESGGPKIPWRPGRVDSYEKKDIPENGNLPDASQDGKYVRNYFKRLGFGDREIVALLGA
HCLGKCHPENSGYDGPWGPSFNMFTNDFFVRLLGSWHVRQWDGEKQYEDDETNSFMMLPT
DIALKEESYFLKYVKLYAADQDLFFADFSKAFATLLELGIEYPRGTKPFLFKTVEEQE
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccattgctatcaagccctcactacttagagctgccaagacatcagctccacgc
ttttctagagctgcctggttggctgctggtttggttggtactgctggtacagccacttac
ttgtacagcaattccaacaactccaactctaacaattccaacaatgccggcaaaaagttg
tccaccttgatggctggagttctcggcgctaatgttgctactgttcctcaaggaaagaca
ttgaaggactaccaagaagtctacaacgacatcgctgctaagattgaagagaacctcgac
tacgatggtggtgctggtttctacggtcaattggtcagattggcatggcattcgtctggt
acctacgataagaacaccaagactggtggttcttactatggtacaatgattttctaccca
gaagcctccgacggagcaaacaacggtttggccaacggccgtgacttcttgtacgaattt
gctgtcaagtatccatggatctccagaggtgacttatggaccttgggaggtgttgttgcc
gtccaggaatctggcggtccaaagatcccatggagaccaggtagagttgactcctacgaa
aagaaggacattcctgaaaacggtaacttgccagatgccagtcaggacggtaagtatgtg
agaaattacttcaagagattgggttttggtgatagagaaatcgttgcattgttaggtgct
cactgtttgggtaagtgccaccctgaaaactctggttacgacggtccatggggtccatcg
ttcaacatgttcaccaacgacttctttgttagattgttgggcagctggcatgtgagacaa
tgggatggtgaaaagcaatacgaagacgacgaaaccaactcgttcatgatgttacctacc
gatattgctttgaaggaagagtcgtacttcttgaagtacgtcaagttgtacgctgctgac
caggacttattctttgctgatttctcaaaggctttcgctaccttgttggaattgggtatt
gagtacccaagaggcaccaagccattcctcttcaagactgttgaagaacaagaatag

DBGET integrated database retrieval system