KEGG   Scheffersomyces stipitis: PICST_87042Help
Entry
PICST_87042       CDS       T01023                                 

Definition
hypothetical protein
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
pic  Scheffersomyces stipitis
Brite
Protein phosphatases and associated proteins [BR:pic01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     PICST_87042
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 174 aa AA seqDB search
MGVASSKIMDSLMEGTNFDREEIDRLRKRFMKLDKDGSGTIDKNEFLSIPGISSNPLATR
LMDVFDEDGDGTIDFQEFITGLSAFSGKTSKVDKLKFAFKIYDIDRDGFIGNGELFIVMK
MMVGKNLQEGELQQIVDKTMMEADKDGDGKLSFEEFKNAVDSKSVSTSLTLNLF
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtggcctcgtccaagatcatggattccctcatggagggcaccaacttcgacaga
gaagaaatcgaccgtttgagaaaacgattcatgaagctcgacaaagacggctcgggaacc
atagacaaaaacgagttcttatctataccggggatttcgtccaatcccttagccacaaga
ttgatggatgtgtttgatgaggatggagatggcaccattgatttccaggagttcatcact
gggttgtctgccttcagcggaaagacatctaaggtcgacaagttgaagtttgcattcaag
atatacgacattgatagagacgggttcattggcaatggagagttattcattgtcatgaag
atgatggtggggaagaacttgcaagaaggcgaattgcaacagatagtcgacaagaccatg
atggaggccgataaagacggtgatggcaagttgagtttcgaagagttcaagaatgccgtg
gattccaagtctgtttccacctcgttgacgcttaatctcttttag

  All links  
No link information was found.   
DBGET integrated database retrieval system