KEGG   Scheffersomyces stipitis: PICST_88514Help
Entry
PICST_88514       CDS       T01023                                 

Definition
(RefSeq) predicted protein
  KO
K09580  protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
pic  Scheffersomyces stipitis
Pathway
pic04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pic00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    PICST_88514
Enzymes [BR:pic01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PICST_88514
Chaperones and folding catalysts [BR:pic03110]
 Protein folding catalysts
  Protein disulfide isomerase
   PICST_88514
Membrane trafficking [BR:pic04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    PICST_88514
Exosome [BR:pic04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   PICST_88514
  Exosomal proteins of colorectal cancer cells
   PICST_88514
  Exosomal proteins of bladder cancer cells
   PICST_88514
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 OST3_OST6 Thioredoxin_2 Thioredoxin_7 Redoxin AhpC-TSA
Motif
Other DBs
NCBI-GeneID: 4837936
NCBI-ProteinID: XP_001383618
JGI: 88514
UniProt: A3LSL2
Position
3
AA seq 555 aa AA seqDB search
MKFWKFSSSVLATLLAVVSVQASGPAEGDAVADPNSAVVKLTAETYKQFLDENPLVLAEY
FAPWCGYCKMLGPEYAKAANSLNETNPNIKLAQIDCTEEEELCRDQGIRGYPTLKVVSNG
AYADYDGPRDAAGIANYMVKQSLPAVQVPADADALTAAIEEQTKPYVIQVGASTDSDAAS
AYEQVAKANRNDYSFFSVEEPALVKELNTKFTNVKVTGKSPSYYVVHPGQLDDVREFEGK
DINADTLTSFVTTEVVPYFGDINRDTYLTYMGSPLPLGYYFYNTAEQRAAFADEFSKLGK
QYRGKINFVGLDATQFGKHAESINMDPAIVPLFAIQDTPNNKKYGVNQKENPEGPSLKTI
KQFVADYLDDKLTPIVKSEDLPTEEEKKANPVVKLVGHNHNEIIEDVSKDIFVKYYAPWC
GHCKKMAPIWEELASVFGSNKDDAKVVVADIDHTNNDVVLPFEIEGYPTLVLYPANGEVD
EKTGLRKPVVFSGARELDAFIDFVKENGALGVDGHVLKAAQDKAAAEAAPEEEEEAAEEV
KEEAAEDEDVEHDEL
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgaagttctggaaattctcatcttctgtgcttgccacccttctcgctgtcgtctctgtc
caagcttcgggaccagccgaaggcgacgctgtcgccgatccaaactccgctgtcgtaaag
cttacggccgagacatacaaacagttccttgacgagaaccctcttgttctcgccgaatac
tttgccccatggtgtggctactgtaagatgttgggacctgaatacgccaaggctgccaac
tcgttgaacgaaaccaacccaaacatcaagttggcccagatcgactgtaccgaggaagaa
gaactctgtcgtgaccaaggtatcagaggctaccctaccttgaaggttgtctccaacggc
gcctatgccgactacgatggccccagagatgccgccggtatcgccaactatatggtcaaa
cagtctttgcctgccgtccaagtgccagctgacgctgacgctttgactgctgctattgaa
gaacagaccaagccatatgtcatccaagtaggtgcttctactgactctgacgccgcttcc
gcctacgagcaagtcgctaaggccaatagaaacgactactctttcttctcagtggaagag
ccagctttggtcaaggaattgaacacgaagtttaccaatgttaaagtaactggcaagtcc
ccttcatactacgtagtccatcctggtcaattggatgacgtaagagaatttgaaggcaag
gacatcaatgctgacactttgaccctgtttgttaccaccgaagttgttccatactttggc
gacatcaacagagacacctacttgacatacatgggttctccattgcctctcggctactac
ttctacaacactgctgaacagagagctgcttttgctgacgaattctcgaagttgggtaag
caataccgtggaaagatcaactttgtcggtttagacgctacccaattcggaaagcacgcc
gagtccatcaacatggacccagcaatcgtgcctttgttcgccatccaagacacaccaaac
aacaagaagtatggtgttaaccaaaaggaaaacccagaaggtccatctttgaagacgatc
aaacagttcgttgctgactacctcgacgacaagttgactcctatcgtcaagtctgaagat
ttgccaaccgaagaagaaaagaaagccaacccagttgtcaagttggtaggccacaaccac
aacgaaatcatcgaagatgtctccaaggacatctttgtcaagtactatgctccatggtgt
ggccactgtaagaagatggctcctatctgggaagaattggcttccgtttttggctccaac
aaggacgacgccaaggtggtcgttgccgacattgaccataccaacaatgacgtcgttctt
cccttcgaaatcgaaggctacccaaccttggttttatatcctgccaacggtgaagttgac
gaaaagaccggcttgagaaagccagttgttttctctggcgcaagagaattagatgccttc
attgactttgtaaaggaaaatggtgcccttggtgttgacggccatgtattgaaggctgct
caagacaaggcagctgctgaagctgctcctgaagaagaagaagaagccgctgaagaagtt
aaagaagaagctgctgaagatgaggatgttgaacacgacgagttgtaa

DBGET integrated database retrieval system